close all open/close all

CDS information : Sch475_00310


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction44,590 / 43,298 / - [in whole cluster]
44,590 / 43,298 / - [in contig]
Locationcomplement(43298..44590) [in whole cluster]
complement(43298..44590) [in contig]
TypeCDS
Length1,293 bp (430 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative glycosyltransferase
Product (GenBank)putative O-glycosyltransferase
Gene
Gene (GenBank)schS10
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
C4NYK9
PmId
[19384899] Cloning and sequencing of the biosynthetic gene cluster for saquayamycin Z and galtamycin B and the elucidation of the assembly of their saccharide chains. (Chembiochem. , 2009)
ACC
Q9RPA2
NITE
Urd_00030
PmId
[10662691] Function of glycosyltransferase genes involved in urdamycin A biosynthesis. (Chem Biol. , 2000)
[11094336] The NDP-sugar co-substrate concentration and the enzyme expression level influence the substrate specificity of glycosyltransferases: cloning and characterization of deoxysugar biosynthetic genes of the urdamycin biosynthetic gene cluster. (Chem Biol. , 2000)

close this sectionSequence

selected fasta
>putative glycosyltransferase [putative O-glycosyltransferase]
MRVLLTIFPATSHLYSVVPLAWALQSAGHEVVVASHSGVVDPGVIGNIGAAGLTAVSLGT
PDELSPALGAHTGDAKPDRPSLGFDPNEPEESGGWRTARSILASMFSLYYPAPERQGGRR
PVLDNLVDFARAWRPDLVLWDPLMLAAPIAARVSGAAHARLVWGMDNVAVIHDRTKRELA
DPRSELTEHPWLSWFGPMLERYGLELDDEMLLGQWTLDLTQSRMRHPLDLTHIPVRRVPY
TGAAALPDWLHARPERPRAVLTLGVSRRKIFGKYSGFPMREFFESVSALDVEVVATLNNE
QLAAVGKVPDNVRTVEYVPLNQVLPTSSAIIHHGGGGTFAAAVAHRVPQLVVPLVMWDEM
VTARYVADMGAGLVADPAALDVDGLHKQLVRLLEDPSFQLGARGLYEEMLAAPAPTDVVP
LLERLTAERR
selected fasta
>putative glycosyltransferase [putative O-glycosyltransferase]
ATGCGTGTCCTGCTCACCATCTTTCCCGCGACGTCACACCTGTACTCGGTCGTGCCGCTT
GCCTGGGCGCTGCAGAGCGCCGGGCACGAGGTCGTCGTGGCGAGCCACTCGGGCGTGGTG
GACCCGGGGGTGATCGGGAACATCGGCGCGGCCGGGCTCACCGCGGTGTCGCTCGGCACC
CCGGACGAGCTGTCCCCGGCGCTCGGTGCGCACACCGGGGACGCCAAGCCGGACCGTCCG
TCGCTGGGCTTCGACCCCAACGAGCCGGAGGAGAGCGGCGGCTGGCGCACGGCGCGCTCC
ATCCTCGCCAGCATGTTCTCGCTGTACTACCCGGCGCCCGAGCGCCAGGGCGGACGCCGC
CCGGTCCTGGACAACCTGGTCGACTTCGCCCGCGCCTGGCGCCCCGATCTGGTCCTGTGG
GACCCCCTGATGCTCGCGGCCCCGATCGCCGCGCGGGTCAGCGGCGCCGCGCACGCCCGG
CTGGTCTGGGGCATGGACAACGTCGCCGTGATCCACGACCGCACGAAGCGCGAACTGGCG
GACCCGCGCTCGGAGTTGACCGAGCATCCGTGGCTGAGCTGGTTCGGCCCGATGCTGGAG
CGGTACGGGCTGGAGCTCGACGACGAGATGCTGCTCGGCCAGTGGACCCTCGACCTGACC
CAGTCCCGGATGCGGCATCCCCTGGACCTGACACACATCCCGGTCCGCCGGGTCCCCTAC
ACCGGGGCGGCCGCACTGCCCGACTGGCTGCACGCGCGGCCCGAGCGGCCCCGCGCGGTG
CTGACCCTGGGGGTGAGCCGGCGCAAGATCTTCGGCAAGTACAGCGGCTTCCCGATGCGC
GAGTTCTTCGAATCCGTGTCCGCCCTGGACGTCGAGGTCGTCGCCACCCTCAACAACGAG
CAGCTCGCGGCGGTCGGCAAGGTGCCCGACAACGTGCGCACCGTCGAGTACGTGCCGCTC
AACCAGGTTCTGCCGACCAGTTCGGCGATCATCCACCACGGAGGCGGCGGCACCTTCGCC
GCGGCCGTGGCCCACCGGGTGCCGCAGCTCGTGGTGCCGCTGGTCATGTGGGACGAGATG
GTCACGGCGCGCTATGTCGCCGACATGGGCGCGGGCCTGGTCGCCGACCCCGCCGCGCTG
GACGTCGACGGCCTGCACAAGCAGCTCGTACGACTCCTCGAGGACCCGTCGTTCCAGCTC
GGCGCGCGCGGCCTGTACGAGGAGATGCTCGCCGCGCCGGCGCCCACGGACGTCGTACCG
CTGCTGGAACGTCTGACCGCCGAGCGCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [3-92]  2.7e-07 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [218-313]  9.40000000000003e-27 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.949 Signal
Eukaryota   
 [1-23]  0.566 Signal
Bacteria, Gram-negative   
 [1-23]  0.477 Signal
Bacteria, Gram-positive   
TMHMM No significant hit