close all open/close all

CDS information : Sch475_00320


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction45,846 / 44,623 / - [in whole cluster]
45,846 / 44,623 / - [in contig]
Locationcomplement(44623..45846) [in whole cluster]
complement(44623..45846) [in contig]
TypeCDS
Length1,224 bp (407 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative major facilitator superfamily transporter
Product (GenBank)putative transporter
Gene
Gene (GenBank)schA20
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Family/Domain
FD
IPR011701

close this sectionSequence

selected fasta
>putative major facilitator superfamily transporter [putative transporter]
MTAVSPRPGAPSVKGSRAHRALLFVLAGNMLIDALEVSVVLVALPALGDDLGLSMWGTQW
VMSGFAAGFAALLLLGPRVTARWGRRRVYLAALLVFVAASVAGGLADQGALLILTRVVKG
MCAALTAPTGLAIIGTTFRAGAEQRRAVSVYSLFGAAGFTVGLLSSGALTALSWRWDLVF
PAPIALLLLVFGFRLIPADAASQAGPPPLRETLVRLWRNGPFVRSAVCAATLNGTYLGLL
LLLTHQLHAQWGWDAWRLALAFLPACVPLALSLPFAGRLVGRFGSERLIVAGGCAATLGS
VTALAGGEPDSYITGVLPTLLLVGAAFVLSFAALNMQAMSGIPADRKGQAVPVYQTAVQL
GAVLALPTVAVLAGAGYRPALLFLTALSAAGALTAVWTRTPLAHTAT
selected fasta
>putative major facilitator superfamily transporter [putative transporter]
ATGACGGCAGTCTCTCCACGCCCCGGTGCCCCTTCGGTGAAGGGGAGCCGCGCCCACCGG
GCCCTTCTGTTCGTGCTCGCCGGGAACATGCTCATCGACGCGCTCGAAGTGTCCGTGGTG
CTGGTCGCGCTGCCGGCCCTCGGGGACGATCTGGGGCTCTCGATGTGGGGCACCCAGTGG
GTGATGAGCGGCTTCGCGGCCGGTTTCGCGGCCCTGCTGCTGCTCGGTCCGCGCGTGACC
GCCCGCTGGGGCAGACGACGCGTGTATCTGGCGGCGCTCCTGGTCTTCGTGGCCGCCTCG
GTGGCCGGTGGCCTGGCCGATCAGGGCGCGCTGCTGATCCTGACCCGGGTCGTCAAGGGC
ATGTGCGCCGCGCTCACCGCACCGACGGGGCTCGCGATCATCGGTACGACCTTCCGGGCA
GGTGCGGAACAGCGCCGGGCCGTGTCGGTGTACTCGCTGTTCGGTGCCGCCGGGTTCACG
GTCGGGCTGCTGTCCTCGGGGGCGCTCACCGCGCTGAGCTGGCGGTGGGATCTCGTCTTC
CCAGCGCCGATCGCCCTGCTCCTGCTGGTGTTCGGCTTCCGGCTGATTCCCGCGGACGCG
GCGTCGCAGGCCGGTCCGCCGCCGCTTCGGGAGACGCTCGTACGGCTGTGGCGCAACGGT
CCTTTCGTCCGCTCCGCGGTCTGCGCGGCGACGCTGAACGGCACGTATCTCGGTCTGCTC
CTGCTCCTCACCCACCAGTTGCACGCCCAATGGGGCTGGGACGCCTGGCGGTTGGCGCTC
GCGTTCCTGCCGGCCTGCGTGCCGCTCGCGCTGTCGCTGCCCTTCGCCGGGCGGCTGGTG
GGGCGTTTCGGGAGCGAGCGGCTGATCGTCGCCGGGGGCTGCGCGGCGACCCTCGGCTCC
GTGACCGCGCTGGCGGGCGGGGAGCCGGACTCGTACATCACCGGGGTGCTGCCGACGCTG
CTGCTGGTCGGCGCGGCCTTCGTGCTGTCGTTCGCCGCTCTCAACATGCAGGCCATGTCC
GGGATTCCGGCCGACCGGAAGGGCCAGGCGGTGCCGGTCTACCAGACCGCCGTACAACTC
GGCGCGGTACTCGCCCTGCCGACCGTGGCCGTGCTGGCCGGTGCCGGATACCGACCGGCG
CTGCTCTTCCTCACCGCCCTGTCGGCGGCCGGCGCGCTCACCGCGGTGTGGACCCGAACT
CCCCTGGCGCACACGGCGACCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR011701 Major facilitator superfamily (Family)
 [30-365]  1e-40 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-404]  4.69998262513195e-55 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [22-403]  PS50850
PS50850   MFS
SignalP
 [1-34]  0.928 Signal
Eukaryota   
TMHMM
 [21-43]  Transmembrane (i-o) [53-75]  Transmembrane (o-i) [88-107]  Transmembrane (i-o) [112-134]  Transmembrane (o-i) [147-169]  Transmembrane (i-o) [179-196]  Transmembrane (o-i) [222-244]  Transmembrane (i-o) [259-281]  Transmembrane (o-i) [288-307]  Transmembrane (i-o) [312-334]  Transmembrane (o-i) [354-376]  Transmembrane (i-o) [380-397]  Transmembrane (o-i)
Transmembrane 12