close all open/close all

CDS information : Sch475_00340


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction48,908 / 47,970 / - [in whole cluster]
48,908 / 47,970 / - [in contig]
Locationcomplement(47970..48908) [in whole cluster]
complement(47970..48908) [in contig]
TypeCDS
Length939 bp (312 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase/dehydratase
Product (GenBank)putative aromatase
Gene
Gene (GenBank)schP4
EC number
Keyword
  • 1st ring
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q54221
NITE
Griseu_00050
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9195917] Domain analysis of the molecular recognition features of aromatic polyketide synthase subunits. (J Biol Chem. , 1997)
[10467128] Heterologous expression, purification, reconstitution and kinetic analysis of an extended type II polyketide synthase. (Chem Biol. , 1999)
ACC
Q56167
NITE
Jado_00120
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative cyclase/dehydratase [putative aromatase]
MTVREVEHEITVEAPAAEVYRLIAEVGNWPLIFPPTVHVDHLERGAREERIRIWATANGA
AKGWTSRRTLDPEARRITFRQEVSAPPVASMGGTWIIEPAGEGASRVRLLHDYRAVDDDP
EGLEWIDQAVDRNSRSELAALKGNVERVTGSAELTLSFTDSLEIKGAAKDVYDFINEAQL
WSERLPHVKQVSLTEDSPGLQVLRMDTLTKDGSVHTTESIRVCFPHSRIVYKQTTLPALM
NLHTGYWQLDESADGVTTATSQHTVILNTENITKILGEEAGIPEAREFIRNALGNNSRAT
LGHAKAYAEARR
selected fasta
>putative cyclase/dehydratase [putative aromatase]
ATGACCGTCCGTGAGGTCGAGCACGAGATCACTGTCGAAGCCCCGGCCGCCGAGGTGTAC
CGGCTGATCGCGGAGGTCGGGAACTGGCCGCTGATCTTCCCGCCGACCGTCCACGTCGAC
CACCTCGAACGCGGCGCGCGCGAGGAGCGCATCCGCATCTGGGCCACCGCCAACGGCGCG
GCCAAGGGCTGGACTTCGCGCCGCACGCTCGACCCCGAGGCCCGGCGCATCACGTTCCGG
CAGGAGGTGTCCGCCCCGCCGGTGGCGTCGATGGGCGGCACGTGGATCATCGAGCCGGCC
GGCGAGGGCGCGTCCCGCGTGCGCCTGCTGCACGACTACCGGGCCGTCGACGACGATCCC
GAGGGCCTGGAGTGGATCGACCAGGCCGTCGACCGCAACAGCCGGTCCGAGCTGGCCGCG
CTGAAGGGCAACGTCGAACGCGTCACCGGCTCCGCCGAGCTGACCCTGTCGTTCACCGAC
AGTCTGGAGATCAAGGGCGCCGCCAAGGACGTCTACGACTTCATCAACGAGGCCCAGCTG
TGGAGCGAGCGGCTGCCGCACGTCAAGCAGGTCTCGCTGACCGAGGACTCGCCCGGCCTG
CAGGTCCTGCGGATGGACACGCTGACCAAGGACGGCTCGGTCCACACCACCGAGTCGATC
CGGGTGTGCTTCCCGCACTCCCGGATCGTCTACAAGCAGACGACGCTGCCCGCGCTGATG
AACCTGCACACCGGTTACTGGCAGCTCGACGAGTCGGCCGACGGCGTCACCACCGCCACC
TCGCAGCACACGGTGATCCTCAACACGGAGAACATCACCAAGATCCTGGGCGAGGAGGCC
GGGATTCCGGAGGCCCGCGAGTTCATCCGCAACGCGCTGGGCAACAACAGCCGGGCGACG
CTCGGCCACGCCAAGGCGTACGCCGAAGCGCGGCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR019587 Polyketide cyclase/dehydrase (Family)
 [5-146]  2e-14 PF10604 [156-309]  3.2e-07 PF10604
PF10604   Polyketide_cyc2
IPR023393 START-like domain (Domain)
 [5-114]  7e-16 G3DSA:3.30.530.20
G3DSA:3.30.530.20   G3DSA:3.30.530.20
SignalP No significant hit
TMHMM No significant hit