close all open/close all

CDS information : Sch475_00350


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction49,735 / 48,935 / - [in whole cluster]
49,735 / 48,935 / - [in contig]
Locationcomplement(48935..49735) [in whole cluster]
complement(48935..49735) [in contig]
TypeCDS
Length801 bp (266 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative polyketide C-9 ketoreductase
Product (GenBank)putative ketoreducatse
Gene
Gene (GenBank)schP5
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q56166
NITE
Jado_00110
PmId
[7881555] Cloning and characterization of polyketide synthase genes for jadomycin B biosynthesis in Streptomyces venezuelae ISP5230. (Microbiology. , 1994)
[9224566] Iterative type II polyketide synthases, cyclases and ketoreductases exhibit context-dependent behavior in the biosynthesis of linear and angular decapolyketides. (Chem Biol. , 1997)

close this sectionSequence

selected fasta
>putative polyketide C-9 ketoreductase [putative ketoreducatse]
MTTATSGNTEKKVAVVTGATSGIGLAVTRLLAEQGHRVFLCARTEDGVTRTVKELLDEGL
DVDGAVCDVREGEDVKRFVRQAVERFGPIDVLVNNAGRSGGGPTAGIADELWYDVIATNL
HSVFLMSREVLNTGGMAAKERGRIINIASTAGKQGVVLGAPYSASKHGVVGFTKALGNEL
APTGITVNAVCPGYVETPMAQRVRQGYAAAYDTSEDAILQKFQAKIPLGRYSTPDEVAGL
VGYLASDTAASITSQALNVCGGLGNF
selected fasta
>putative polyketide C-9 ketoreductase [putative ketoreducatse]
ATGACGACTGCCACGTCCGGCAACACGGAGAAGAAGGTCGCCGTCGTCACCGGCGCGACC
AGCGGTATCGGCCTCGCGGTGACCCGGCTCCTCGCCGAGCAGGGTCACCGGGTGTTCCTG
TGCGCCCGCACCGAGGACGGTGTCACCCGCACGGTCAAGGAGCTGCTCGACGAGGGCCTC
GACGTCGACGGCGCCGTCTGCGACGTACGCGAGGGCGAGGACGTGAAGCGCTTCGTGCGG
CAGGCCGTCGAGCGCTTCGGCCCCATCGACGTCCTGGTCAACAACGCGGGCCGCAGCGGC
GGCGGTCCCACCGCCGGCATCGCCGACGAACTCTGGTACGACGTCATCGCCACGAACCTG
CACAGCGTGTTCCTGATGAGCCGCGAGGTGCTCAACACGGGCGGCATGGCGGCCAAGGAG
CGCGGCCGGATCATCAACATCGCCTCCACGGCAGGAAAGCAGGGTGTCGTGCTCGGCGCC
CCCTACTCGGCCTCCAAGCACGGCGTCGTCGGCTTCACCAAAGCCCTCGGCAACGAACTG
GCCCCGACCGGCATCACCGTCAACGCCGTGTGCCCCGGCTATGTCGAGACGCCGATGGCC
CAGCGCGTACGGCAGGGCTATGCGGCCGCGTACGACACCTCCGAGGACGCGATCCTGCAG
AAGTTCCAGGCGAAGATCCCGCTCGGCCGCTACTCCACGCCCGACGAGGTGGCCGGCCTG
GTCGGCTACCTCGCCTCGGACACCGCCGCCTCCATCACCTCGCAGGCCCTGAACGTCTGC
GGCGGCCTCGGCAATTTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [87-98]  1.20000117458134e-14 PR00080 [142-150]  1.20000117458134e-14 PR00080 [162-181]  1.20000117458134e-14 PR00080
PR00080   SDRFAMILY
 [12-180]  1.40000000000001e-36 PF00106
PF00106   adh_short
 [1-253]  6.69999687625999e-17 PIRSF000126
PIRSF000126   11-beta-HSD1
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [13-30]  1.40000506907309e-49 PR00081 [87-98]  1.40000506907309e-49 PR00081 [136-152]  1.40000506907309e-49 PR00081 [162-181]  1.40000506907309e-49 PR00081 [183-200]  1.40000506907309e-49 PR00081 [227-247]  1.40000506907309e-49 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [5-263]  4.59999999999996e-83 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [149-177]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-32]  0.652 Signal
Bacteria, Gram-positive   
TMHMM
 [13-32]  Transmembrane (i-o)
Transmembrane 1