close all open/close all

CDS information : Sch475_00360


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction50,037 / 49,768 / - [in whole cluster]
50,037 / 49,768 / - [in contig]
Locationcomplement(49768..50037) [in whole cluster]
complement(49768..50037) [in contig]
TypeCDS
Length270 bp (89 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase acyl carrier protein subunit
Product (GenBank)putative acyl carrier protein
Gene
Gene (GenBank)schP6
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q54219
NITE
Griseu_00030
PmId
[8169211] Cloning, sequencing, and analysis of the griseusin polyketide synthase gene cluster from Streptomyces griseus. (J Bacteriol. , 1994)
[9108302] Post-translational modification of heterologously expressed Streptomyces type II polyketide synthase acyl carrier proteins. (FEBS Lett. , 1997)
[9738947] Acylation of Streptomyces type II polyketide synthase acyl carrier proteins. (FEBS Lett. , 1998)

close this sectionPKS/NRPS Module

ACP7..80

close this sectionSequence

selected fasta
>polyketide synthase acyl carrier protein subunit [putative acyl carrier protein]
MPAHEFTIEDLRRILRDGAGTDEAVDLDGDILDTDFESLGYESLALLETSGRIEREFGIT
LDDDTVTEAKTPRALIGAVNTFLVPVRSS
selected fasta
>polyketide synthase acyl carrier protein subunit [putative acyl carrier protein]
ATGCCCGCTCACGAGTTCACCATCGAAGACCTTCGGCGCATTCTGCGCGACGGGGCCGGC
ACCGATGAGGCCGTCGACCTGGACGGCGACATCCTCGACACGGACTTCGAGTCTCTCGGA
TACGAGTCCCTGGCCCTGCTGGAGACCAGCGGCCGGATCGAGCGCGAGTTCGGGATCACG
CTCGACGACGACACGGTGACGGAGGCGAAGACACCTCGCGCGCTGATCGGCGCCGTCAAC
ACCTTCCTGGTGCCCGTCCGGTCCAGCTGA
ACP7..80
ACP19..240

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006162 Phosphopantetheine attachment site (PTM)
 [38-53]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [11-78]  6.00000000000001e-10 PF00550
PF00550   PP-binding
 [5-80]  6.60000000000002e-16 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [7-80]  PS50075
PS50075   ACP_DOMAIN
 [3-83]  4.30000170645867e-14 SSF47336
SSF47336   ACP_like
SignalP
 [1-24]  0.035 Signal
Bacteria, Gram-negative   
TMHMM No significant hit