close all open/close all

CDS information : Sch475_00370


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction51,323 / 50,097 / - [in whole cluster]
51,323 / 50,097 / - [in contig]
Locationcomplement(50097..51323) [in whole cluster]
complement(50097..51323) [in contig]
TypeCDS
Length1,227 bp (408 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase chain length factor subunit
Product (GenBank)putative chain length factor
Gene
Gene (GenBank)schP7
EC number
Keyword
  • type II PKS
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q54174
NITE
Urd_00130
PmId
[7592377] Cloning and characterization of a polyketide synthase gene from Streptomyces fradiae Tu2717, which carries the genes for biosynthesis of the angucycline antibiotic urdamycin A and a gene probably involved in its oxygenation. (J Bacteriol. , 1995)

close this sectionPKS/NRPS Module

CLF5..363

close this sectionSequence

selected fasta
>polyketide synthase chain length factor subunit [putative chain length factor]
MSAAVRVAVTGLGVAAPNGLGVEAYWAATRAGASGIGRVTRFDPAQYPARLAGEIKEFSG
LEHLPARLLPQTDRMTQVALAGTDWAFADAGVDPAELSEYDMGVITASSSGGFEFGQKEL
KALWSQGSRYVSAYQSFAWFYAVNSGQISIRNGMRGPSGVVVGDQAGGLDAVAQARRQIR
KGTPLVVSGGIDASICPWGWVAQMAGDRLSTSDDPARAYVPFDAAARGHVPGEGGALLVL
EDLERARERGARQIYGEIAGYGSTFDPRPGGGRPPGLRKAIELALADAESSAGDIDVVFA
DGAALPELDRIEADAITGVFGARGVPVSVPKTMTGRLYSGAAPLDLAAAFLAIRDGVIPA
SVGTRLSDAYALDLVTDRPRDAAVRSALVLARGQGGFNSAVVVRAVDK
selected fasta
>polyketide synthase chain length factor subunit [putative chain length factor]
ATGAGCGCCGCCGTACGGGTGGCCGTCACCGGGCTCGGTGTCGCCGCGCCCAACGGCCTC
GGCGTGGAGGCGTACTGGGCGGCGACCCGGGCCGGCGCCAGCGGCATCGGCCGGGTCACC
CGCTTCGACCCCGCGCAGTACCCGGCCCGACTGGCGGGCGAGATCAAGGAGTTCAGCGGC
CTTGAGCATCTCCCGGCCCGGCTGCTGCCGCAGACCGACCGCATGACACAGGTCGCCCTG
GCCGGGACGGACTGGGCGTTCGCCGACGCGGGCGTCGATCCCGCCGAGCTGTCCGAGTAC
GACATGGGTGTCATCACGGCGAGCTCCTCGGGCGGCTTCGAGTTCGGCCAGAAGGAACTC
AAGGCGCTCTGGAGCCAGGGCAGTCGGTACGTCAGCGCCTACCAGTCGTTCGCCTGGTTC
TACGCCGTCAACAGCGGCCAGATCTCCATCCGCAACGGAATGCGTGGCCCCAGCGGGGTG
GTCGTCGGCGACCAGGCGGGCGGCCTCGACGCGGTCGCACAGGCCCGGCGGCAGATCCGC
AAGGGCACGCCGCTGGTGGTGTCCGGCGGGATCGACGCCTCGATCTGCCCCTGGGGCTGG
GTCGCCCAGATGGCCGGGGACCGGCTGAGCACCAGCGACGACCCGGCGCGGGCGTACGTG
CCCTTCGACGCGGCGGCGCGCGGGCATGTCCCGGGCGAGGGCGGCGCGCTGCTCGTCCTG
GAGGACCTGGAGCGGGCCCGCGAGCGTGGAGCCCGGCAGATCTACGGGGAGATCGCGGGG
TACGGCTCCACCTTCGACCCCCGGCCCGGCGGCGGACGTCCTCCGGGCCTGCGCAAGGCG
ATCGAACTCGCGCTGGCCGACGCGGAGTCGAGTGCCGGCGACATCGACGTGGTGTTCGCC
GACGGTGCCGCCCTGCCCGAGCTCGACCGCATCGAGGCCGACGCGATCACCGGTGTCTTC
GGGGCCCGCGGGGTCCCGGTCAGCGTGCCCAAGACGATGACCGGACGGCTGTACTCCGGG
GCGGCCCCGCTGGATCTGGCCGCCGCGTTCCTCGCCATCCGGGACGGCGTGATCCCGGCC
TCGGTCGGCACCCGTCTCAGCGACGCCTACGCCCTCGACCTGGTCACCGACCGCCCGCGC
GACGCCGCGGTCCGCTCGGCCCTGGTCCTCGCCCGCGGGCAGGGCGGCTTCAACTCGGCC
GTGGTGGTACGGGCCGTCGACAAGTGA
CLF5..363
CLF13..1089

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [5-243]  1.40000000000001e-54 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [255-363]  3.09999999999998e-24 PF02801
PF02801   Ketoacyl-synt_C
IPR016038 Thiolase-like, subgroup (Domain)
 [5-260]  8.79999999999995e-56 G3DSA:3.40.47.10 [273-406]  7.29999999999999e-33 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [4-251]  6.4999795054176e-61 SSF53901 [214-406]  2.99998750445706e-45 SSF53901
SSF53901   Thiolase-like
SignalP
 [1-24]  0.267 Signal
Bacteria, Gram-positive   
 [1-21]  0.884 Signal
Eukaryota   
TMHMM No significant hit