close all open/close all

CDS information : Sch475_00390


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction52,932 / 52,606 / - [in whole cluster]
52,932 / 52,606 / - [in contig]
Locationcomplement(52606..52932) [in whole cluster]
complement(52606..52932) [in contig]
TypeCDS
Length327 bp (108 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productputative cyclase
Product (GenBank)putative cyclase
Gene
Gene (GenBank)schP9
EC number
Keyword
  • angucycline
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9XCV6
NITE
Jado_00070
PmId
[11520231] Production of aromatic minimal polyketides by the daunorubicin polyketide synthase genes reveals the incompatibility of the heterologous DpsY and JadI cyclases. (J Nat Prod. , 2001)
ACC
Q93LY5
PmId
[12654660] Engineering anthracycline biosynthesis toward angucyclines. (Antimicrob Agents Chemother. , 2003)

close this sectionSequence

selected fasta
>putative cyclase [putative cyclase]
MHSTLIVARMEPGSADDVARLFNRFDDTEMPHLMGTRRRQLFSYRGLYFHLQDFDNEDGG
ERIEQAKTDPRFVGISDDLKPFIEAYDPATWRSPADAMAQRFYHWTAL
selected fasta
>putative cyclase [putative cyclase]
ATGCACAGCACGCTGATCGTGGCTCGAATGGAGCCCGGATCCGCCGACGACGTCGCGCGT
CTGTTCAACAGGTTCGACGACACCGAGATGCCGCACCTCATGGGCACCCGGCGCCGCCAG
CTCTTCTCGTACCGGGGTCTCTACTTCCATCTGCAGGACTTCGACAACGAGGACGGCGGC
GAGCGGATCGAGCAGGCCAAGACGGACCCCCGGTTCGTCGGGATCAGCGACGACCTCAAG
CCGTTCATCGAGGCGTACGACCCGGCGACCTGGCGCTCCCCCGCCGACGCGATGGCCCAG
CGCTTCTACCACTGGACCGCACTGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006765 Polyketide synthesis cyclase (Family)
 [2-107]  PD012644
PD012644   Polyketide_synth_cyclase
 [10-107]  8.89999999999994e-44 PF04673
PF04673   Cyclase_polyket
 [1-107]  1.99999999999999e-50 G3DSA:3.30.70.1090
G3DSA:3.30.70.1090   Cyclase_polyket
IPR011008 Dimeric alpha-beta barrel (Domain)
 [1-108]  1.3000049540733e-45 SSF54909
SSF54909   Dimer_A_B_barrel
SignalP No significant hit
TMHMM No significant hit