close all open/close all

CDS information : Sch475_00420


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction56,477 / 55,722 / - [in whole cluster]
56,477 / 55,722 / - [in contig]
Locationcomplement(55722..56477) [in whole cluster]
complement(55722..56477) [in contig]
TypeCDS
Length756 bp (251 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative TetR family transcriptional regulator
Product (GenBank)putative tetR-family regulatory protein
Gene
Gene (GenBank)schA21
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9F0Y2
PmId
[11050092] A transcriptional regulator of a pristinamycin resistance gene in Streptomyces coelicolor. (J Biol Chem. , 2001)
ACC
Q9AJL5
NITE
Virg_00370
PmId
[11222601] Identification of the varR gene as a transcriptional regulator of virginiamycin S resistance in Streptomyces virginiae. (J Bacteriol. , 2001)

close this sectionSequence

selected fasta
>putative TetR family transcriptional regulator [putative tetR-family regulatory protein]
MATRRKEEKQVTPEPSEPRETVSLWERLNRPAPAPRSTLTPQRIAAAAVAIADTEGLDAV
TMRRLAADLGAAPMAAYRYVSGKDELLELMVDHVYGELSLPGDAKDWRNAMRALALRTRT
VLLRHSWVARTAVFTLTPNQLAVPERALAALDGLDLDADTMMAVFRTVDSYVQGAVGFEI
GLNELMREQGWSSANEARTGLAPRMTWLMGTDRYPTYERYLREASRKDDLEWQFETGLES
VLDGISARLGI
selected fasta
>putative TetR family transcriptional regulator [putative tetR-family regulatory protein]
ATGGCCACTCGGAGAAAAGAGGAGAAGCAGGTGACGCCGGAGCCGTCCGAGCCCAGGGAG
ACCGTCTCGCTCTGGGAACGCCTCAACCGCCCCGCACCCGCCCCTCGCTCCACGCTCACC
CCGCAGCGCATCGCCGCGGCCGCCGTGGCGATCGCCGACACGGAAGGCCTCGACGCCGTC
ACCATGCGGCGCCTCGCGGCCGACCTGGGGGCCGCGCCGATGGCGGCGTACCGCTATGTC
TCCGGCAAGGACGAGCTGCTGGAGCTGATGGTCGACCACGTCTACGGCGAGCTGTCGCTG
CCCGGGGACGCCAAGGACTGGCGGAACGCCATGCGGGCGCTCGCCCTGCGCACCAGGACC
GTGCTCCTCAGGCACTCGTGGGTGGCCCGCACGGCGGTGTTCACACTGACCCCGAACCAG
CTGGCCGTGCCCGAGCGGGCCCTGGCCGCGCTCGACGGGCTCGACCTGGACGCCGACACG
ATGATGGCGGTCTTCCGCACCGTCGACTCCTATGTGCAGGGCGCCGTGGGCTTCGAGATC
GGCCTCAACGAGCTGATGCGGGAGCAGGGCTGGTCCAGCGCGAACGAGGCGCGCACCGGT
CTGGCCCCACGCATGACATGGCTGATGGGCACCGACCGTTACCCGACGTACGAGCGCTAC
CTCCGCGAGGCGAGCCGCAAGGACGACCTGGAGTGGCAGTTCGAGACGGGCCTCGAGTCG
GTCCTCGACGGGATCTCCGCACGCCTGGGCATCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001647 DNA-binding HTH domain, TetR-type (Domain)
 [45-88]  5.29999999999999e-09 PF00440
PF00440   TetR_N
 [38-98]  PS50977
PS50977   HTH_TETR_2
IPR004111 Tetracycline transcriptional regulator, TetR, C-terminal (Domain)
 [101-249]  1.99999999999999e-18 PF02909
PF02909   TetR_C
IPR009057 Homeodomain-like (Domain)
 [36-98]  8.19999506482837e-12 SSF46689
SSF46689   Homeodomain_like
 [30-92]  1.99999999999999e-20 G3DSA:1.10.10.60
G3DSA:1.10.10.60   Homeodomain-rel
IPR011075 Tetracycline transcriptional regulator, TetR-related, C-terminal (Domain)
 [105-250]  1.70000295590054e-26 SSF48498
SSF48498   TetR_like_C
IPR015893 Tetracycline transcriptional regulator, TetR-like, C-terminal (Domain)
 [93-249]  2.4e-26 G3DSA:1.10.357.10
G3DSA:1.10.357.10   TetR_C
SignalP No significant hit
TMHMM No significant hit