close all open/close all

CDS information : Sch475_00430


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction56,595 / 57,194 / + [in whole cluster]
56,595 / 57,194 / + [in contig]
Location56595..57194 [in whole cluster]
56595..57194 [in contig]
TypeCDS
Length600 bp (199 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)hypothetical protein
GeneschA22
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • schA22
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9ZGB0
NITE
Lando_00300
PmId
[15812784] Generation of novel landomycins M and O through targeted gene disruption. (Chembiochem. , 2005)
[22454092] Elucidation of post-PKS tailoring steps involved in landomycin biosynthesis. (Org Biomol Chem. , 2012)
ACC
Q6T1C6
PmId
[15123249] Generation of new landomycins by combinatorial biosynthetic manipulation of the LndGT4 gene of the landomycin E cluster in S. globisporus. (Chem Biol. , 2004)
ACC
Q07923
PmId
[15184374] Crystal structure and functional characterization of yeast YLR011wp, an enzyme with NAD(P)H-FMN and ferric iron reductase activities. (J Biol Chem. , 2004)

close this sectionSequence

selected fasta
>putative oxidoreductase [hypothetical protein]
MSDLNDSPLQVAALVGSTRGGRFGPVVADWLLSQIAQRKDMEVDLVDLVETPLPTVMPAF
GEQLPDEDMALLGAVAPRMESADAFIIITPEYNHSYPAALKNAIDWHNPQWHAKPVAFVS
YGGISGGLRAVEHLRLVLAELNAMTIRNTVSFHNYGDKFDSDGKPLDPDCDVAAKALLDQ
LAWWGEALRDARTARPYTG
selected fasta
>putative oxidoreductase [hypothetical protein]
ATGAGTGACCTGAACGACAGCCCTCTGCAGGTGGCGGCCCTCGTCGGCAGCACGAGGGGC
GGACGCTTCGGTCCGGTCGTGGCCGACTGGCTGCTGAGCCAGATCGCCCAGCGCAAGGAC
ATGGAGGTCGACCTCGTCGACCTGGTCGAGACGCCCCTGCCGACCGTCATGCCGGCTTTC
GGGGAGCAACTTCCGGACGAGGACATGGCTCTGCTAGGCGCGGTCGCCCCGCGCATGGAG
TCGGCCGACGCCTTCATCATCATCACGCCGGAGTACAACCACAGTTATCCGGCGGCCCTG
AAGAACGCGATCGACTGGCACAACCCGCAGTGGCACGCCAAGCCCGTCGCCTTCGTCTCC
TACGGCGGCATCTCCGGCGGCCTGCGCGCCGTCGAGCACCTGCGGCTGGTCCTCGCCGAG
CTGAACGCCATGACGATCCGCAACACCGTCAGCTTCCACAACTACGGCGACAAGTTCGAC
TCGGACGGCAAGCCCCTCGACCCGGACTGTGACGTCGCGGCCAAGGCCCTGCTCGACCAA
CTGGCCTGGTGGGGAGAGGCGCTTCGGGACGCCCGCACCGCTCGTCCGTACACCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005025 NADPH-dependent FMN reductase (Domain)
 [10-156]  6.6999999999999e-40 PF03358
PF03358   FMN_red
SignalP No significant hit
TMHMM No significant hit