close all open/close all

CDS information : Sch475_00440


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction57,209 / 58,792 / + [in whole cluster]
57,209 / 58,792 / + [in contig]
Location57209..58792 [in whole cluster]
57209..58792 [in contig]
TypeCDS
Length1,584 bp (527 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.3 transport
Productputative drug resistance transporter
Product (GenBank)putative transporter
Gene
Gene (GenBank)schA23
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9ZGB6
NITE
Lando_00240
PmId
[18537830] Coordination of export and glycosylation of landomycins in Streptomyces cyanogenus S136. (FEMS Microbiol Lett. , 2008)

close this sectionSequence

selected fasta
>putative drug resistance transporter [putative transporter]
MTSDTTETGGTADTAPQTAGKLPYLGIFGLMLGIFLATLDGQIVSIALPTIVGDLGGLDH
FSWSVTAYLLTMAAATPIWGKLGDLKGRKGAYMWSVLLFLVGTVLCGLAQDMPQLIAFRA
VQGLGAGGLMVGALSVIGVLVPAHERGRVQSMVGVMLPVAFVGGPLLGGFITDTLDWRWV
FYVNVPFGVLALFAVARGVRLPKERSGGRIDYPGTALLTTAILSLTLLATWAGTRYDWGS
AQIVLLAVVAAVAVAAFVRVEQRVAEPVIPPRLFRSRDFALAQTLSFLVGAVLVSVINYL
PQYMQFVQGSTSTVSGMQILPLMMGMLAAQLTTGRLMDRGGLERVVPITGGAVTVVGALL
LLLLDTDTPVFVASALTLVLGIGVGILMQSTLLTTMNTAPPRDMGAATGTVTLLRTIGGS
LGVAALGAVHLGRMTDELTGRLGERGAEQLTSGGELTPSSVDGMSGRVRGVVQEAFTSGL
HGVLIGTALLSAVAFALAWFVRGTPAPKTPEPAGDSRPAQVPATTTD
selected fasta
>putative drug resistance transporter [putative transporter]
ATGACCAGCGACACGACGGAGACCGGCGGCACCGCGGACACGGCTCCGCAGACCGCCGGG
AAGCTGCCCTACCTCGGCATCTTCGGACTCATGCTCGGCATCTTCCTGGCCACCCTCGAC
GGACAGATCGTCAGCATCGCCCTGCCGACCATCGTCGGTGACCTCGGCGGCCTCGACCAC
TTCTCCTGGTCCGTCACGGCCTACCTGCTCACGATGGCGGCCGCCACTCCGATCTGGGGC
AAGCTCGGCGACCTCAAGGGCCGCAAGGGCGCCTACATGTGGTCCGTGCTGCTCTTCCTG
GTCGGCACCGTCCTGTGCGGACTCGCCCAGGACATGCCACAGCTCATCGCCTTCCGCGCC
GTCCAGGGCCTCGGCGCCGGCGGACTGATGGTCGGCGCGCTGTCGGTCATCGGCGTGCTG
GTTCCGGCGCACGAGCGCGGCCGCGTCCAGTCGATGGTCGGCGTGATGCTGCCGGTCGCC
TTCGTCGGCGGGCCGCTGCTCGGCGGCTTCATCACCGACACCCTCGACTGGCGCTGGGTG
TTCTACGTCAACGTGCCCTTCGGTGTCCTCGCGCTGTTCGCGGTCGCCAGAGGCGTACGG
CTGCCGAAGGAGCGTTCCGGCGGACGGATCGACTACCCCGGTACGGCGCTGCTGACCACC
GCCATCCTCTCGCTCACCCTGCTGGCCACCTGGGCCGGCACCCGCTACGACTGGGGATCG
GCACAGATCGTGCTGCTCGCCGTCGTCGCTGCCGTGGCCGTCGCCGCATTCGTCCGGGTC
GAACAGCGGGTGGCGGAACCCGTCATCCCGCCGCGGCTGTTCCGCAGCCGTGACTTCGCC
CTCGCCCAGACGCTCAGCTTCCTGGTCGGAGCCGTACTGGTCTCGGTCATCAACTACCTG
CCCCAGTACATGCAGTTCGTGCAGGGCTCCACCTCCACCGTAAGCGGCATGCAGATCCTG
CCCCTGATGATGGGCATGCTCGCGGCGCAGCTGACCACCGGGCGGCTGATGGACCGCGGC
GGCCTGGAGCGGGTGGTGCCGATCACCGGGGGCGCCGTCACGGTCGTCGGCGCGCTGCTG
CTGCTCCTGCTGGACACGGACACCCCGGTGTTCGTCGCCTCGGCCCTCACTCTGGTGCTC
GGCATCGGCGTCGGCATCCTGATGCAGAGCACGCTGCTCACCACGATGAACACGGCACCG
CCGCGCGACATGGGTGCCGCCACCGGAACGGTCACGCTACTGCGCACGATCGGCGGTTCA
CTCGGCGTCGCCGCGCTCGGCGCCGTGCACCTGGGCCGTATGACGGACGAGCTCACCGGC
CGGCTGGGCGAGCGCGGCGCCGAACAGCTCACCTCCGGCGGCGAGTTGACCCCGTCTTCG
GTCGACGGGATGTCCGGTCGAGTGCGGGGTGTCGTCCAGGAGGCCTTCACCAGCGGACTG
CACGGCGTCCTCATCGGCACCGCCCTGCTCTCGGCCGTCGCCTTCGCCCTCGCCTGGTTC
GTCCGTGGGACCCCGGCCCCCAAGACCCCCGAACCCGCCGGGGATTCGCGGCCCGCCCAG
GTCCCCGCGACGACCACGGACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004638 Drug resistance transporter EmrB/QacA subfamily (Family)
 [27-428]  4.40000000000003e-79 TIGR00711
TIGR00711   Efflux_EmrB
IPR011701 Major facilitator superfamily (Family)
 [30-422]  4.6e-52 PF07690
PF07690   MFS_1
IPR016196 Major facilitator superfamily domain, general substrate transporter (Domain)
 [1-518]  4.99996518094122e-76 SSF103473
SSF103473   MFS_gen_substrate_transporter
IPR020846 Major facilitator superfamily domain (Domain)
 [26-506]  PS50850
PS50850   MFS
SignalP
 [1-41]  0.413 Signal
Eukaryota   
TMHMM
 [24-46]  Transmembrane (i-o) [61-83]  Transmembrane (o-i) [90-109]  Transmembrane (i-o) [119-141]  Transmembrane (o-i) [153-172]  Transmembrane (i-o) [177-199]  Transmembrane (o-i) [212-234]  Transmembrane (i-o) [239-258]  Transmembrane (o-i) [279-301]  Transmembrane (i-o) [345-364]  Transmembrane (o-i) [371-393]  Transmembrane (i-o) [413-432]  Transmembrane (o-i) [479-501]  Transmembrane (i-o)
Transmembrane 13