close all open/close all

CDS information : Sch475_00450


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction58,880 / 59,998 / + [in whole cluster]
58,880 / 59,998 / + [in contig]
Location58880..59998 [in whole cluster]
58880..59998 [in contig]
TypeCDS
Length1,119 bp (372 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative oxidoreducatse
Gene
Gene (GenBank)schA24
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
P32382
PmId
[8357835] Cloning, sequencing and expression of the gene encoding NADH oxidase from the extreme anaerobic thermophile Thermoanaerobium brockii. (Biochim Biophys Acta. , 1993)
Family/Domain
FD
IPR001155

close this sectionSequence

selected fasta
>putative oxidoreductase [putative oxidoreducatse]
MSTTSAERAKEVLLRPFTLGSLTLANRIVMAPMTREFSPGGVPGDDVAAYYARRAAGGAG
LVITEGTYIGHDSAGTSDRVPHIHGEQALAGWAKVTKAVHNAGGKILSQLWHVGLDRKAG
SPPVPEAPSIGPSGIAVDGTPVGRAMTQTDIDDVVAAYAAAAAAAERTGFDGIEVHAAHG
YLIDQFLWEQTNRRTDAYGGDLGARTRFATEIVAACRGAVAPDFPITFRFSQWKMGAYQA
RLAGSPQELETLLAPLSDAGVDAFHCSTRRFHLPEFEGSELNLAGWTKKVSGKPTISVGS
VGLDNEFIEVFQGKPGSVAGIDALLDRVERDEFDLVAVGRALLGDPEWITKILGGRTEEL
QPFHMGLLGTLH
selected fasta
>putative oxidoreductase [putative oxidoreducatse]
ATGTCGACCACCTCCGCCGAGCGCGCCAAGGAAGTCCTGCTGCGCCCCTTCACCCTGGGC
AGTCTCACTCTTGCCAACCGGATCGTGATGGCACCGATGACCCGGGAGTTCTCGCCGGGT
GGCGTACCGGGCGACGACGTGGCGGCGTACTACGCGCGGCGCGCGGCGGGCGGCGCCGGC
CTCGTCATCACCGAGGGGACGTACATCGGCCACGACTCGGCCGGTACCAGCGACCGCGTC
CCCCACATCCACGGCGAGCAGGCCCTGGCAGGCTGGGCCAAGGTGACGAAGGCGGTGCAC
AACGCGGGCGGGAAGATCCTGTCGCAGCTGTGGCACGTGGGACTGGACCGGAAGGCCGGC
TCCCCGCCTGTACCCGAGGCCCCGAGCATCGGCCCCTCCGGCATCGCTGTCGACGGCACG
CCCGTCGGCCGCGCCATGACGCAGACCGACATCGACGATGTCGTCGCCGCCTACGCCGCG
GCGGCAGCGGCCGCCGAGCGGACCGGCTTCGACGGCATCGAGGTGCACGCGGCCCACGGC
TATCTGATCGACCAGTTCCTCTGGGAGCAGACCAACCGCCGCACCGACGCGTACGGCGGT
GACCTGGGTGCCCGTACCCGGTTCGCCACAGAGATCGTCGCCGCCTGCCGCGGGGCGGTC
GCCCCGGACTTCCCGATCACCTTCCGGTTCTCGCAGTGGAAGATGGGTGCTTATCAGGCC
AGGCTCGCGGGATCGCCGCAGGAGCTCGAAACCCTGCTTGCCCCCCTGTCGGACGCCGGG
GTGGACGCCTTCCACTGCTCGACCCGCCGCTTCCACCTGCCCGAGTTCGAGGGATCCGAG
CTCAACCTCGCCGGCTGGACGAAGAAGGTCTCGGGCAAGCCCACGATCAGCGTCGGCTCG
GTCGGCCTCGACAACGAGTTCATCGAGGTGTTCCAGGGGAAGCCGGGCTCGGTCGCCGGG
ATCGACGCGCTGCTCGACCGGGTGGAGCGCGACGAGTTCGACCTGGTGGCCGTCGGCCGC
GCACTGCTCGGTGACCCCGAGTGGATCACGAAGATCCTGGGTGGCCGGACCGAGGAACTC
CAGCCCTTCCACATGGGGCTTCTGGGTACCCTTCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001155 NADH:flavin oxidoreductase/NADH oxidase, N-terminal (Domain)
 [13-358]  6.99999999999989e-71 PF00724
PF00724   Oxidored_FMN
IPR013785 Aldolase-type TIM barrel (Domain)
 [11-360]  1.99999999999999e-98 G3DSA:3.20.20.70
G3DSA:3.20.20.70   Aldolase_TIM
SignalP
 [1-31]  0.466 Signal
Bacteria, Gram-positive   
TMHMM No significant hit