close all open/close all

CDS information : Sch475_00460


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction60,257 / 61,093 / + [in whole cluster]
60,257 / 61,093 / + [in contig]
Location60257..61093 [in whole cluster]
60257..61093 [in contig]
TypeCDS
Length837 bp (278 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative transcriptional regulator
Product (GenBank)putative repressor-response regulator
Gene
Gene (GenBank)schA25
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q66PH7
PmId
[12757959] Production of landomycins in Streptomyces globisporus 1912 and S cyanogenus S136 is regulated by genes encoding putative transcriptional activators. (FEMS Microbiol Lett. , 2003)
[17786405] Function of lanI in regulation of landomycin A biosynthesis in Streptomyces cyanogenus S136 and cross-complementation studies with Streptomyces antibiotic regulatory proteins encoding genes. (Arch Microbiol. , 2008)
ACC
Q56HA6
PmId
[16079347] Characterization of a regulatory gene essential for the production of the angucycline-like polyketide antibiotic auricin in Streptomyces aureofaciens CCM 3239. (Microbiology. , 2005)
[20466770] The role of the TetR-family transcriptional regulator Aur1R in negative regulation of the auricin gene cluster in Streptomyces aureofaciens CCM 3239. (Microbiology. , 2010)
[21584781] Genetic manipulation of pathway regulation for overproduction of angucycline-like antibiotic auricin in Streptomyces aureofaciens CCM 3239. (Folia Microbiol (Praha). , 2011)

close this sectionSequence

selected fasta
>putative transcriptional regulator [putative repressor-response regulator]
MSNQSTKFLEPAIPQQLANRRAPTPSRPVSQHAQQHPPIQAQQLPPIQAQPQLRKARGVL
RVLVVESGAPAAQSLVLSLARHGYQAVSVDTGSKALQKYREADVLLIDLDLPDLDGIEIC
RFVRAASGVGVIVVTARDTELDRVLSLKAGADDYVVKPYSLPELMARIEAVMRRVRPLPL
TTEVISSGPLRIDSRTREIRLGDEPVEVTRKEFDLLYLLASRPGSVVSRKQIMTLVWGDS
RSQPGRTIDTHVSSLRSKLGSSSWIITARGVGFRFGHA
selected fasta
>putative transcriptional regulator [putative repressor-response regulator]
ATGAGCAATCAGTCCACAAAATTTCTCGAGCCCGCCATTCCGCAACAACTGGCCAATCGC
CGCGCGCCAACGCCGTCGCGCCCAGTGAGCCAACATGCCCAGCAGCATCCGCCCATACAG
GCCCAGCAACTACCGCCCATCCAGGCCCAGCCTCAGCTGCGCAAGGCGCGCGGGGTGTTG
CGTGTCCTCGTTGTCGAGAGCGGGGCGCCCGCCGCCCAGTCCCTGGTTCTGAGTCTGGCC
AGGCACGGGTACCAGGCCGTGAGCGTGGACACCGGCAGTAAGGCGCTCCAGAAGTACCGG
GAAGCGGATGTCCTGCTCATCGACCTGGACCTGCCCGACCTGGACGGCATCGAGATCTGC
CGTTTCGTCAGGGCCGCGTCCGGGGTCGGAGTCATCGTTGTCACGGCCCGCGACACGGAA
CTCGACCGCGTGCTCAGCCTCAAGGCGGGCGCGGACGACTATGTGGTGAAGCCCTACAGT
CTGCCCGAGCTGATGGCCCGTATCGAAGCCGTCATGCGACGGGTGCGCCCGCTGCCACTG
ACCACCGAAGTGATCAGCAGCGGCCCGTTGCGGATCGACTCGCGCACCCGTGAGATCCGG
CTCGGCGACGAGCCCGTCGAAGTGACGCGCAAGGAGTTCGACCTGCTTTATCTGCTGGCC
TCGCGGCCGGGCAGCGTCGTTTCCCGAAAGCAAATCATGACACTGGTCTGGGGCGATTCC
CGCTCCCAGCCGGGTCGCACGATCGACACGCATGTCAGTAGTCTCCGCAGTAAACTCGGA
TCCAGCAGCTGGATCATCACGGCCCGCGGTGTCGGTTTCCGATTCGGTCATGCGTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001789 Signal transduction response regulator, receiver domain (Domain)
 [60-168]  1.6e-29 SM00448
SM00448   cheY-homologous receiver domain
 [61-172]  31.613 PS50110
PS50110   RESPONSE_REGULATORY
 [62-168]  6.6e-19 PF00072
PF00072   Response_reg
IPR001867 Signal transduction response regulator, C-terminal (Domain)
 [203-275]  1.1e-22 SM00862
SM00862   Transcriptional regulatory protein, C ter
 [204-275]  4.2e-21 PF00486
PF00486   Trans_reg_C
IPR011006 CheY-like superfamily (Domain)
 [60-245]  1.8e-30 SSF52172
SSF52172   CheY-like
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [182-275]  9.9e-27 G3DSA:1.10.10.10
G3DSA:1.10.10.10   no description
SignalP No significant hit
TMHMM No significant hit