close all open/close all

CDS information : Sch475_00470


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction63,931 / 62,333 / - [in whole cluster]
63,931 / 62,333 / - [in contig]
Locationcomplement(62333..63931) [in whole cluster]
complement(62333..63931) [in contig]
TypeCDS
Length1,599 bp (532 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productputative FAD-dependent oxidoreductase
Product (GenBank)putative oxidoreducatse
Gene
Gene (GenBank)schA26
EC number
Keyword
  • L-aculose
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q0PCD7
NITE
Acla_00150
PmId
[17242508] Structure determination by multiwavelength anomalous diffraction of aclacinomycin oxidoreductase: indications of multidomain pseudomerohedral twinning. (Acta Crystallogr D Biol Crystallogr. , 2007)
[17395717] Aclacinomycin oxidoreductase (AknOx) from the biosynthetic pathway of the antibiotic aclacinomycin is an unusual flavoenzyme with a dual active site. (Proc Natl Acad Sci U S A. , 2007)

close this sectionSequence

selected fasta
>putative FAD-dependent oxidoreductase [putative oxidoreducatse]
MVSRRTFLGTSIVVAGTTTGLSAVAPAAHAGTTAAAAVPPEVIVRPGDTRYAELAGRGYN
TRFRAAPDEIWLVHNASQVEKAVTQAIRKDQRITVRSGGHCFDGLVDDPQFRLLVDTSEM
KRVYFDSSMNAFAVESGARLGEVYKALYEGWGVTLPGGVCPEVGVGGHVSGGGYGPLSRR
YGLSVDHLYAVEVVVAGSDGKARTIVATSRRSDPNRDLWWAHTGGGGGQFGIVTRFWFRT
PGASGAPTALLPKPPARMRKSLVTWQWSDITEAGFTRLLLNHGAWHAANSGPDSPYATMH
SSFQLRSSLVGSFVLEIRMDATLAATPKLFDDYLAAVSAGVGVTPAVDTREMPWVEAATE
PTPPFGTYSRHKSIGGHLRKPLTAAQVGVVYRSLTDPEHSTGAGLVYLAAYGCKINTVSS
SATAVAQRDSIFKVWYSTNWSEPSADAAEVEWIRTLRKGVHSATGGFPVPNDQQDGGYVN
YPDVDIRDPYQNSSGVPWYTILYKDNHPRLQRVKNTYDPRNVFRHGLSLNPS
selected fasta
>putative FAD-dependent oxidoreductase [putative oxidoreducatse]
ATGGTTTCGCGCCGCACGTTCCTTGGCACCTCGATAGTTGTGGCCGGTACCACGACGGGC
CTGTCCGCCGTGGCACCGGCCGCCCACGCCGGCACGACCGCCGCCGCGGCCGTTCCGCCC
GAGGTGATCGTCAGACCCGGCGACACGCGCTACGCCGAGCTGGCGGGGCGCGGCTACAAC
ACCCGCTTCCGAGCCGCCCCGGACGAGATCTGGCTGGTGCACAACGCCTCCCAGGTGGAG
AAGGCGGTCACCCAGGCGATCCGCAAGGACCAGCGGATCACCGTACGCAGCGGCGGCCAC
TGCTTCGACGGCCTGGTTGACGACCCCCAGTTCCGTCTCCTCGTCGACACCTCGGAGATG
AAGCGGGTCTACTTCGACAGCTCGATGAACGCCTTCGCCGTCGAGTCCGGCGCCCGGCTC
GGCGAGGTCTACAAGGCGCTGTACGAGGGCTGGGGCGTGACCCTGCCCGGCGGCGTCTGC
CCCGAGGTCGGTGTCGGCGGGCATGTGTCCGGCGGCGGTTACGGGCCTCTGTCCCGGCGC
TACGGACTGTCGGTCGACCATCTGTACGCGGTCGAGGTGGTGGTCGCGGGCAGCGACGGC
AAGGCTCGTACGATCGTCGCGACCAGCCGCCGCAGCGACCCGAACCGCGACCTGTGGTGG
GCGCACACCGGTGGTGGCGGCGGTCAGTTCGGCATCGTGACCAGGTTCTGGTTCCGCACG
CCGGGCGCGTCGGGAGCCCCCACCGCGCTGCTGCCCAAGCCGCCCGCCCGGATGCGCAAG
TCCCTTGTGACCTGGCAGTGGTCGGACATCACCGAGGCCGGCTTCACCCGGCTGCTGCTC
AACCACGGTGCCTGGCACGCGGCCAACAGCGGGCCCGACTCGCCGTACGCCACCATGCAC
AGCTCCTTCCAACTGCGTTCGTCGCTGGTCGGGTCGTTCGTGCTGGAAATCCGGATGGAC
GCGACGCTCGCCGCCACCCCGAAGCTGTTCGACGACTACCTGGCCGCGGTGTCGGCCGGT
GTCGGTGTCACGCCGGCGGTCGACACACGGGAGATGCCCTGGGTGGAGGCGGCCACCGAG
CCGACGCCCCCGTTCGGCACGTACTCCCGGCACAAGTCCATCGGCGGGCATCTGCGCAAG
CCGCTGACGGCAGCTCAGGTCGGCGTCGTGTACCGGTCGTTGACGGATCCCGAGCACTCC
ACCGGCGCCGGTCTCGTGTACCTCGCGGCATACGGCTGCAAGATCAACACGGTGTCGTCG
TCGGCGACGGCCGTGGCCCAGCGGGACTCCATCTTCAAGGTCTGGTACTCGACCAACTGG
TCCGAGCCGTCGGCCGACGCGGCCGAGGTCGAGTGGATCAGAACGCTGCGCAAGGGCGTC
CACAGCGCCACGGGCGGCTTCCCGGTCCCGAACGACCAGCAGGACGGCGGATACGTCAAC
TACCCCGACGTGGACATCAGGGACCCGTACCAGAACTCCTCGGGCGTGCCCTGGTACACG
ATCCTCTACAAGGACAACCACCCCCGGCTGCAGCGGGTCAAGAACACGTACGACCCGCGC
AACGTCTTCAGGCACGGCCTCTCGTTGAACCCGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006094 FAD linked oxidase, N-terminal (Domain)
 [70-202]  9e-21 PF01565
PF01565   FAD_binding_4
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-30]  PS51318
PS51318   TAT
IPR012951 Berberine/berberine-like (Domain)
 [478-528]  3.1e-14 PF08031
PF08031   BBE
IPR016166 FAD-binding, type 2 (Domain)
 [63-243]  PS51387
PS51387   FAD_PCMH
 [48-244]  3.59998852907783e-36 SSF56176
SSF56176   FAD-binding_2
IPR016168 FAD-linked oxidase, FAD-binding, subdomain 2 (Domain)
 [125-239]  1.1e-07 G3DSA:3.30.465.20
G3DSA:3.30.465.20   FAD-linked_oxidase_FAD-bd_sub2
SignalP
 [1-30]  1 Signal
Bacteria, Gram-negative   
 [1-36]  0.983 Signal
Eukaryota   
 [1-36]  1 Signal
Bacteria, Gram-positive   
TMHMM No significant hit