close all open/close all

CDS information : Sch475_00480


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction64,954 / 64,202 / - [in whole cluster]
64,954 / 64,202 / - [in contig]
Locationcomplement(64202..64954) [in whole cluster]
complement(64202..64954) [in contig]
TypeCDS
Length753 bp (250 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative IclR family transcriptional regulator
Product (GenBank)putative transcriptional regulator
Gene
Gene (GenBank)schA27
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
P42968
PmId
[9334321] A novel histidine kinase inhibitor regulating development in Bacillus subtilis. (Genes Dev. , 1997)

close this sectionSequence

selected fasta
>putative IclR family transcriptional regulator [putative transcriptional regulator]
MTGPSAPDRLLAVLAAFDHDHPALSLTDISRRAGLSLTTAHRLVGALSDWGALERDASGI
YHVGLRLWEIAALSPRGLALRQIALPYLEDLYEATHENVQLAVRDGSEVVYIEWISGRSA
VGVKIQVGARWPLHATGVGLALLAHCEAAFQETYCGGHLAGFTPHTITDGAVLRRVLAEV
RHAGVAVSTRQITDDALSVAAPVRGADGSVAAAVSVVVPERDAQTPALIPAVRLAARGIS
RALGWQPEPS
selected fasta
>putative IclR family transcriptional regulator [putative transcriptional regulator]
ATGACCGGGCCGTCCGCCCCCGACCGCCTGCTGGCCGTGCTCGCCGCCTTCGACCACGAC
CACCCGGCGCTCTCCCTCACGGACATCAGCCGCCGGGCCGGGCTCTCCCTCACCACCGCC
CACCGGCTGGTGGGCGCGCTCAGCGACTGGGGCGCCCTGGAGCGCGACGCGTCCGGGATC
TACCACGTGGGCCTGCGCCTGTGGGAGATCGCGGCGCTCTCCCCGCGCGGTCTCGCGCTG
CGGCAGATCGCGCTGCCGTATCTGGAGGACCTGTACGAAGCCACCCACGAGAACGTGCAG
TTGGCGGTCCGGGACGGCTCCGAGGTCGTCTACATAGAGTGGATCTCCGGCCGTTCGGCC
GTGGGCGTGAAGATCCAGGTGGGCGCCCGCTGGCCACTGCACGCGACCGGCGTGGGTCTC
GCGCTGCTCGCCCACTGCGAGGCCGCCTTCCAGGAGACGTACTGCGGCGGGCATCTCGCC
GGATTCACCCCGCACACCATCACGGACGGGGCCGTCCTGCGCCGCGTACTCGCCGAAGTC
CGCCACGCGGGCGTGGCGGTGAGCACCCGTCAGATCACCGACGACGCCCTGTCGGTGGCC
GCGCCGGTCCGTGGGGCGGACGGCTCGGTGGCCGCGGCCGTCTCCGTCGTGGTGCCCGAA
CGCGACGCGCAGACACCGGCGTTGATCCCTGCGGTACGGCTCGCGGCGCGCGGCATCTCG
CGGGCGCTGGGGTGGCAGCCGGAGCCGTCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005471 Transcription regulator IclR, N-terminal (Domain)
 [8-56]  2.3e-13 PF09339
PF09339   HTH_IclR
 [4-93]  2.49999811956465e-31 SM00346
SM00346   HTH_ICLR
 [4-65]  PS51077
PS51077   HTH_ICLR
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [5-66]  1.5e-17 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
IPR014757 Transcription regulator IclR, C-terminal (Domain)
 [123-241]  3.60000000000001e-25 PF01614
PF01614   IclR
 [66-245]  PS51078
PS51078   ICLR_ED
SignalP
 [1-25]  0.9 Signal
Eukaryota   
TMHMM No significant hit