close all open/close all

CDS information : Sch475_00490


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction65,672 / 66,589 / + [in whole cluster]
65,672 / 66,589 / + [in contig]
Location65672..66589 [in whole cluster]
65672..66589 [in contig]
TypeCDS
Length918 bp (305 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)putative 3-Oxoacyl carrier protein reducatse
Gene
Gene (GenBank)schA28
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
P51831
PmId
[8759840] Bacillus subtilis acyl carrier protein is encoded in a cluster of lipid biosynthesis genes. (J Bacteriol. , 1996)

close this sectionSequence

selected fasta
>putative oxidoreductase [putative 3-Oxoacyl carrier protein reducatse]
MPSIDLTGKVAVVTGSGRGLGLAYAHALAAAGASVVVNDVDEDVAEQAVKAITEAGGTAV
AEVVPVGTTEAADRLVGRAVSEFGRLDILVTNAGILRDKVLWKMTDEDFDAVITTHLKGT
FTCARAAAVRMREQGEGGTLILVGSPAGQRGNFGQTNYAAAKAGIAAMARTWSMELGRAG
ITVNAIVPVAATAMTETIPAFAPYIEAMRGGEPLPEFLRKGEGFGTPEDCAALVPFLASE
AARGVTGQAIGIGGDKVALWSHPQEIKAAYADGGWTPDSLADVWPASLGAEPQSVGIPAP
KFPEA
selected fasta
>putative oxidoreductase [putative 3-Oxoacyl carrier protein reducatse]
GTGCCCAGCATCGATCTCACCGGCAAGGTCGCCGTCGTCACCGGCTCCGGCCGTGGCCTC
GGCCTGGCCTATGCGCACGCCCTGGCCGCCGCAGGCGCCTCCGTGGTCGTCAACGACGTG
GACGAGGACGTCGCCGAGCAGGCCGTCAAGGCGATCACCGAGGCGGGCGGCACCGCCGTG
GCCGAGGTGGTCCCGGTCGGCACCACCGAGGCCGCGGACCGGCTGGTGGGCCGCGCGGTG
TCGGAGTTCGGCCGCCTCGACATCCTGGTCACCAACGCGGGCATCCTTCGGGACAAGGTC
CTGTGGAAGATGACCGACGAGGACTTCGACGCGGTGATCACCACCCACCTCAAGGGCACC
TTCACCTGCGCCCGCGCCGCCGCCGTACGCATGCGCGAACAGGGCGAGGGCGGCACGCTG
ATCCTCGTCGGCTCCCCGGCCGGACAGCGCGGCAACTTCGGCCAGACGAACTACGCCGCC
GCCAAGGCCGGCATCGCCGCCATGGCCCGTACGTGGTCGATGGAGCTGGGCCGTGCGGGC
ATCACCGTCAACGCGATCGTGCCGGTGGCCGCAACGGCGATGACCGAGACCATCCCGGCC
TTCGCGCCCTACATCGAGGCCATGCGCGGCGGCGAGCCGCTGCCGGAGTTCCTCCGCAAG
GGCGAGGGCTTCGGCACCCCCGAAGACTGCGCCGCCCTCGTCCCGTTCCTGGCCTCCGAG
GCCGCCCGCGGGGTGACCGGCCAGGCCATCGGCATCGGCGGCGACAAGGTCGCCCTGTGG
TCCCACCCCCAGGAGATCAAGGCGGCGTACGCTGACGGTGGCTGGACCCCCGATTCCCTC
GCCGACGTCTGGCCGGCCTCGCTGGGCGCCGAGCCGCAGTCGGTCGGCATCCCCGCCCCG
AAGTTCCCGGAGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [84-95]  3.4e-07 PR00080 [138-146]  3.4e-07 PR00080 [158-177]  3.4e-07 PR00080
PR00080   SDRFAMILY
 [9-176]  7.9e-32 PF00106
PF00106   adh_short
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [10-27]  2.2e-28 PR00081 [84-95]  2.2e-28 PR00081 [132-148]  2.2e-28 PR00081 [158-177]  2.2e-28 PR00081 [179-196]  2.2e-28 PR00081 [220-240]  2.2e-28 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [2-253]  4.1e-69 G3DSA:3.40.50.720
G3DSA:3.40.50.720   no description
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [9-192]  0.0001 SM00822
SM00822   no description
IPR020904 Short-chain dehydrogenase/reductase, conserved site (Conserved_site)
 [145-173]  PS00061
PS00061   ADH_SHORT
SignalP
 [1-29]  0.403 Signal
Bacteria, Gram-positive   
TMHMM No significant hit