close all open/close all

CDS information : Sch475_00500


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction66,593 / 67,477 / + [in whole cluster]
66,593 / 67,477 / + [in contig]
Location66593..67477 [in whole cluster]
66593..67477 [in contig]
TypeCDS
Length885 bp (294 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GeneschA29
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • schA29
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTNIDVEELVAIDVHTHAEVSSKGTSSLDDDLHEASSAYFKVEGNRKPTLEETAAYYRER
KMAAVIFTVDAESATGTAPVPNEEVAEAAAANADVLIPFASIDPFRGRAGVKQARRLVEE
YGVKGFKFHPSIQGFFPNDRSVAYELYEVIEETGTIALFHTGQTGIGAGVPGGGGIRLKY
SNPLHVDDVAADFPHLKIILAHPSFPWQDEALAVATHKPGVHIDLSGWSPKYFPPQLVQY
ANTLLKDKVLFGSDYPVLTPDRWMADFAKLSIKDEVRPKILKENAARLLGLTKP
selected fasta
>hypothetical protein [hypothetical protein]
ATGACGAACATCGATGTCGAGGAACTCGTCGCGATCGACGTCCACACCCACGCCGAGGTC
TCCTCCAAGGGCACCTCCTCCCTGGACGACGACCTGCACGAGGCCTCCAGCGCCTACTTC
AAGGTCGAGGGCAACCGGAAGCCGACCCTGGAGGAGACGGCCGCCTACTACCGTGAGCGG
AAGATGGCTGCCGTGATCTTCACGGTCGACGCCGAGTCCGCCACCGGCACCGCGCCCGTC
CCGAACGAGGAGGTCGCCGAGGCTGCCGCCGCCAACGCGGACGTGCTGATCCCGTTCGCC
TCCATCGACCCCTTCCGCGGCAGGGCGGGCGTCAAGCAGGCCCGCCGCCTGGTCGAGGAG
TACGGGGTGAAGGGCTTCAAGTTCCACCCCAGCATCCAGGGCTTCTTCCCCAACGACAGG
TCGGTCGCGTACGAGCTGTACGAGGTGATCGAGGAGACCGGCACGATCGCCCTCTTCCAC
ACCGGACAGACGGGCATCGGCGCGGGCGTCCCGGGCGGCGGCGGGATCAGGCTCAAGTAC
TCCAACCCGCTGCACGTGGACGACGTGGCCGCGGACTTCCCGCACCTCAAGATTATTCTG
GCGCACCCGTCCTTCCCCTGGCAGGACGAGGCCCTCGCGGTCGCCACCCACAAGCCGGGC
GTCCACATCGACCTGTCCGGCTGGTCGCCGAAGTACTTCCCGCCGCAGCTCGTGCAGTAC
GCGAACACGCTGCTCAAGGACAAGGTGCTGTTCGGTTCCGACTACCCGGTCCTCACCCCG
GATCGGTGGATGGCCGACTTCGCGAAGCTCTCCATCAAGGACGAGGTCAGGCCGAAGATC
CTCAAGGAGAACGCGGCCCGGCTGCTCGGGCTGACGAAGCCGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006992 Amidohydrolase 2 (Family)
 [12-291]  1.99999999999999e-60 PF04909
PF04909   Amidohydro_2
SignalP No significant hit
TMHMM No significant hit