close all open/close all

CDS information : Sch475_00510


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction67,521 / 69,065 / + [in whole cluster]
67,521 / 69,065 / + [in contig]
Location67521..69065 [in whole cluster]
67521..69065 [in contig]
TypeCDS
Length1,545 bp (514 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative carboxylic acid--CoA ligase
putative acyl-CoA synthetase
Product (GenBank)feruloyl-CoA synthetase
Gene
Gene (GenBank)schA30
EC number6.2.1.-
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q9EY88
PmId
[11152072] Identification of Amycolatopsis sp. strain HR167 genes, involved in the bioconversion of ferulic acid to vanillin. (Appl Microbiol Biotechnol. , 2000)

close this sectionSequence

selected fasta
>putative carboxylic acid--CoA ligase [feruloyl-CoA synthetase]
MKDRGTDMRNEGLGSWPARRARKTPHRTALIHGDTTVTYAGLYERTTRLAHALRDSGVRR
GDRIAYLGPNHPSYLETLFAAGTLGAVFVPLNTRLAGPELAYQLTDSGAKALVYGPTFGG
LVAGLPGNSDVRTYVEVGAEYDQLLDMASDEAIDEPVIPDDTCIIMYTSGTTGRPKGAML
THGNLTWNAVNVLVDQDVITDERALVSAPLFHTAGLNMLTLPVLLKGGTCVLVEAFDPAA
TFDLIERHRITFMFGVPTMFEHVARHPRWADADLSSLRMLSCGGSPVPTPLIAAYQERGL
TFLQGYGMTEASPGVLFLDAEHAVTKAGSAGVPHFFSDVRVVRPDLAPADIGETGEVVVR
GPHVMPGYWGLPDETAAVFHDGWFRSGDAARIDEDGYVTIVDRLKDMIISGGENIYPAEI
EDQLLAHPDIVECAVIGVPDEKWGEVPRAVVVPREDVALDPDEVLASLAGRLAKYKIPKS
VVLADELPRTASGKLLKSRVRKRYGTNSQSKEDT
selected fasta
>putative carboxylic acid--CoA ligase [feruloyl-CoA synthetase]
ATGAAGGACAGGGGCACGGACATGCGCAATGAGGGACTGGGGTCGTGGCCCGCACGCCGG
GCCCGCAAGACCCCGCACCGCACCGCCCTGATCCACGGCGACACGACGGTCACCTACGCC
GGGCTGTACGAGCGCACCACCCGCCTCGCACACGCCCTGCGCGACTCCGGGGTGCGCCGC
GGCGACCGGATCGCCTACCTCGGCCCGAACCACCCCTCCTACCTGGAGACGCTGTTCGCC
GCGGGCACCCTCGGGGCGGTCTTCGTACCGCTCAACACCCGCCTCGCCGGACCCGAACTC
GCCTACCAGCTCACGGACTCCGGCGCGAAGGCCCTCGTGTACGGGCCCACGTTCGGCGGC
CTCGTCGCGGGGCTGCCTGGCAACAGCGACGTGCGTACGTACGTCGAAGTGGGCGCCGAA
TACGACCAGTTGCTCGACATGGCCTCCGACGAGGCCATCGACGAACCCGTCATCCCCGAC
GACACCTGCATCATCATGTACACCTCGGGCACGACGGGCCGGCCCAAGGGCGCGATGCTC
ACCCACGGCAATCTGACGTGGAACGCGGTCAACGTCCTGGTCGACCAGGACGTGATCACC
GACGAACGCGCCCTGGTCTCCGCCCCGTTGTTCCACACGGCCGGGCTGAACATGCTGACC
CTGCCGGTCCTCCTCAAGGGCGGTACGTGCGTCCTGGTCGAGGCCTTCGATCCGGCCGCC
ACCTTCGACCTGATCGAGCGGCACCGGATCACCTTCATGTTCGGCGTGCCCACCATGTTC
GAGCACGTGGCCCGCCATCCGCGCTGGGCCGACGCCGACCTGTCCTCCCTGCGGATGCTC
AGCTGCGGCGGCTCACCCGTGCCGACCCCGCTCATCGCCGCCTACCAGGAGCGGGGCCTC
ACCTTCCTCCAGGGCTACGGCATGACGGAGGCCTCGCCCGGCGTGCTCTTCCTGGACGCC
GAGCACGCGGTCACCAAGGCGGGTTCGGCGGGCGTGCCGCACTTCTTCAGCGACGTCCGC
GTCGTACGGCCCGACCTCGCCCCCGCCGACATCGGCGAGACCGGGGAAGTGGTCGTACGC
GGGCCGCATGTCATGCCCGGCTACTGGGGGCTGCCCGACGAGACCGCTGCCGTGTTCCAC
GACGGCTGGTTCCGCAGCGGGGACGCCGCCCGGATCGACGAGGACGGCTACGTCACCATC
GTCGACCGCCTCAAGGACATGATCATCTCGGGCGGCGAGAACATCTACCCCGCCGAGATC
GAGGACCAGCTCCTCGCCCATCCCGACATCGTCGAGTGCGCGGTCATCGGAGTGCCCGAC
GAGAAGTGGGGCGAGGTGCCGCGCGCGGTCGTCGTGCCCCGCGAGGACGTCGCGCTCGAC
CCCGACGAGGTCCTCGCGTCCCTCGCCGGACGCCTCGCCAAGTACAAGATCCCGAAGTCG
GTGGTGCTCGCGGACGAACTGCCGCGCACGGCCTCCGGCAAGCTCCTCAAGTCCCGTGTC
CGCAAGCGGTACGGCACCAACTCCCAGTCGAAGGAAGACACATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000873 AMP-dependent synthetase/ligase (Domain)
 [38-435]  3.19999999999996e-116 PF00501
PF00501   AMP-binding
IPR020845 AMP-binding, conserved site (Conserved_site)
 [165-176]  PS00455
PS00455   AMP_BINDING
IPR025110 Domain of unknown function DUF4009 (Domain)
 [475-502]  1e-06 PF13193
PF13193   DUF4009
SignalP No significant hit
TMHMM No significant hit