close all open/close all

CDS information : Sch475_00520


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction70,409 / 69,585 / - [in whole cluster]
70,409 / 69,585 / - [in contig]
Locationcomplement(69585..70409) [in whole cluster]
complement(69585..70409) [in contig]
TypeCDS
Length825 bp (274 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category4.1 transcriptional regulator
Productputative regulatory protein
Product (GenBank)phenyl acetic acid responsive transcriptional repressor
Gene
Gene (GenBank)schA31
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
P76086
PmId
[10766858] Transcriptional regulation of the divergent paa catabolic operons for phenylacetic acid degradation in Escherichia coli. (J Biol Chem. , 2000)
[9748275] Catabolism of phenylacetic acid in Escherichia coli. Characterization of a new aerobic hybrid pathway. (J Biol Chem. , 1998)

close this sectionSequence

selected fasta
>putative regulatory protein [phenyl acetic acid responsive transcriptional repressor]
MTTDEALRPQSLMLSFLGDQVLGRDVCVYSGSVIDVFGRAGVGEHATRSTLTRMVGRDLL
RRQREGRRMYFGLTERSESVLRDGEQRIWEDGAVNRQWDGSWTLLGFSLPESWQRQRHDL
RAQLAWSGFGPLFGGLWIAPGEADVSAIVAELGLSAHVKIFRAHADAGMDIGAMIEETWA
LGELATRYEAFTHRWQRWETTEPAADEALALRLRLSTEWLQVVRRDPRLPVKHLPDNWPA
EQAEKTFRTVYARLTPLARESAERLLDLVPVRAP
selected fasta
>putative regulatory protein [phenyl acetic acid responsive transcriptional repressor]
GTGACCACTGACGAGGCGCTGCGGCCCCAGTCCCTCATGCTGTCGTTCCTGGGTGACCAG
GTGCTCGGCCGTGACGTCTGCGTGTACTCGGGGAGCGTCATCGACGTCTTCGGGCGCGCG
GGCGTCGGCGAGCACGCGACCCGCTCGACGCTGACGCGCATGGTGGGCCGCGATCTGCTC
AGGCGGCAGCGCGAGGGACGCCGGATGTACTTCGGGCTGACCGAGCGCTCGGAGTCCGTG
CTGCGGGACGGCGAGCAGCGGATCTGGGAGGACGGGGCCGTCAACCGGCAGTGGGACGGC
TCCTGGACGCTGCTCGGCTTCTCGCTGCCGGAGTCCTGGCAGCGTCAACGGCACGATCTG
CGCGCGCAGTTGGCCTGGAGCGGCTTCGGCCCGCTGTTCGGCGGGCTGTGGATCGCACCC
GGCGAGGCCGACGTCTCCGCGATCGTCGCCGAACTCGGTCTGTCCGCCCATGTGAAGATC
TTCCGGGCCCACGCGGACGCGGGCATGGACATCGGCGCCATGATCGAGGAGACCTGGGCA
CTGGGCGAACTGGCCACGCGCTACGAGGCGTTCACGCACCGCTGGCAGCGCTGGGAGACG
ACGGAGCCCGCCGCCGACGAGGCTCTCGCACTGCGGCTGCGCCTGTCGACGGAGTGGCTG
CAGGTCGTCCGCCGGGACCCGCGCCTACCGGTCAAACACCTCCCGGACAACTGGCCCGCC
GAACAGGCCGAGAAGACGTTCCGCACGGTGTACGCCCGACTGACCCCACTCGCAAGGGAG
TCGGCGGAACGCCTTCTCGACCTGGTGCCGGTTCGCGCCCCATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR012906 PaaX-like, N-terminal (Domain)
 [8-76]  2.7e-10 PF07848
PF07848   PaaX
IPR013225 PaaX-like, C-terminal (Domain)
 [96-256]  1.5e-43 PF08223
PF08223   PaaX_C
SignalP
 [1-23]  0.614 Signal
Eukaryota   
TMHMM No significant hit