close all open/close all

CDS information : Sch475_00530


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction72,167 / 70,497 / - [in whole cluster]
72,167 / 70,497 / - [in contig]
Locationcomplement(70497..72167) [in whole cluster]
complement(70497..72167) [in contig]
TypeCDS
Length1,671 bp (556 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)hypothetical protein
GeneschA32
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • schA32
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [hypothetical protein]
MTEQQLPAWADPSVSPAALDAQGVSRRQLMRRAGLFGAAFAAGSLATPAMASAKGFGGND
PRLAYLVGDHHVHSVYSHDAKYTFSQLAQASAKYGLDWMVFNEHSNFGHAQYGAKLEHEE
ILKARAKNPRQLIFQGLEWYIPGAEHCTIFAAPGRHEVDLLTQFELAYDGKLLGYTAGAP
THPDTPRNEAHAVKAIKWLAAQRRSGYVDDVLVFANHPMRLGIDSPHEMRNWRDAAPEIM
IGMEGAPGAQGGAIPGWRGPTSIRGEYENKPSADSWPAYPTDSYLTYGGFDWMTATVGGM
WDAMLSEGKLFTITTNSDVHRVVFDTWKNGDWLPGQNFDNTGRLPDPVNTTEPQPGGDFW
PGQFSRTHVGVSRYGYRAVMAGLRAGRVWLDHGHLLDGLDVRLKRDCDHGRGVTLGSRLR
VRKGEKLTLNVTVTTASRPNPHDILPKLAHVDVIRGAVRGPAADRDTWRAPATKVVHTAD
VSGRKGTYTLRIPLTAGDESFYVRLRGSDGNRHGAGYLGASVDPHGPIPHAPGDGDPWLD
TWFYSNPVFVEVAGHR
selected fasta
>hypothetical protein [hypothetical protein]
ATGACCGAGCAGCAGCTGCCCGCCTGGGCAGATCCGTCCGTCTCCCCCGCCGCCCTCGAC
GCGCAGGGCGTGTCCCGACGTCAGCTCATGCGCCGCGCGGGCCTGTTCGGCGCCGCCTTC
GCCGCCGGATCGCTGGCGACGCCCGCCATGGCGAGCGCGAAGGGTTTCGGCGGCAACGAC
CCGCGCCTCGCCTACCTCGTCGGCGACCACCACGTGCACTCCGTCTACAGCCACGACGCG
AAGTACACGTTCTCCCAACTGGCGCAGGCGAGCGCCAAGTACGGCCTCGACTGGATGGTG
TTCAACGAGCACTCCAACTTCGGGCACGCCCAGTACGGGGCGAAGCTGGAGCACGAGGAG
ATCCTCAAGGCACGCGCCAAGAACCCGCGTCAGCTGATCTTCCAGGGCCTGGAGTGGTAC
ATCCCGGGCGCCGAGCACTGCACGATCTTCGCGGCGCCCGGCCGCCACGAGGTGGACCTG
CTCACGCAGTTCGAGCTGGCCTACGACGGCAAGCTGCTCGGCTACACGGCGGGCGCGCCC
ACCCACCCCGACACCCCGCGCAACGAGGCGCACGCCGTCAAGGCCATCAAGTGGCTGGCC
GCACAGCGCCGTTCGGGCTACGTGGACGACGTACTGGTCTTCGCCAACCACCCGATGCGC
CTGGGCATCGACTCCCCGCACGAGATGCGGAACTGGCGGGACGCGGCCCCCGAGATCATG
ATCGGCATGGAGGGCGCGCCGGGTGCGCAGGGCGGTGCCATCCCTGGCTGGCGCGGTCCG
ACGTCGATACGCGGCGAGTACGAGAACAAGCCGTCGGCCGACTCCTGGCCCGCCTATCCG
ACGGACTCGTACCTCACGTACGGCGGCTTCGACTGGATGACGGCGACCGTCGGCGGCATG
TGGGACGCCATGCTCTCCGAGGGCAAGCTGTTCACGATCACCACCAACTCCGATGTGCAC
CGGGTGGTGTTCGACACCTGGAAGAACGGCGACTGGCTGCCGGGGCAGAACTTCGACAAC
ACGGGCCGGCTGCCCGACCCGGTCAACACCACCGAGCCACAGCCCGGCGGCGACTTCTGG
CCCGGCCAGTTCAGCCGCACGCACGTCGGCGTGTCCCGCTACGGCTACCGCGCGGTGATG
GCGGGCCTGCGCGCGGGCCGCGTCTGGCTCGACCACGGCCATCTGCTCGACGGTCTCGAC
GTACGGCTGAAGCGGGACTGCGACCACGGCCGGGGCGTCACGCTGGGCAGTCGGCTGCGG
GTCCGCAAGGGTGAGAAGCTCACCCTGAACGTGACCGTGACGACGGCCTCGCGGCCCAAC
CCGCACGACATCCTGCCCAAGCTGGCCCACGTGGACGTCATCCGCGGCGCGGTGCGCGGT
CCGGCGGCCGACCGGGACACCTGGCGGGCACCGGCCACCAAGGTCGTGCACACGGCGGAC
GTGTCCGGCCGCAAGGGCACGTACACCCTGCGCATCCCGCTGACCGCCGGGGACGAGTCC
TTCTACGTGCGGCTGCGCGGCAGCGACGGCAACCGGCACGGCGCCGGATACCTGGGCGCG
TCGGTCGACCCGCACGGGCCGATCCCGCACGCGCCGGGCGACGGTGATCCGTGGCTCGAC
ACGTGGTTCTACTCCAACCCGGTGTTCGTGGAGGTCGCCGGCCACCGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004013 PHP, C-terminal (Domain)
 [69-184]  2.7e-06 PF02811
PF02811   PHP
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-53]  PS51318
PS51318   TAT
IPR016195 Polymerase/histidinol phosphatase-like (Domain)
 [63-396]  1.49999977583352e-12 SSF89550
SSF89550   PHP-like
SignalP
 [1-41]  0.36 Signal
Bacteria, Gram-positive   
 [1-53]  0.838 Signal
Eukaryota   
TMHMM No significant hit