close all open/close all

CDS information : Sch475_00540


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction74,051 / 72,198 / - [in whole cluster]
74,051 / 72,198 / - [in contig]
Locationcomplement(72198..74051) [in whole cluster]
complement(72198..74051) [in contig]
TypeCDS
Length1,854 bp (617 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)putative secreted protein
Gene
Gene (GenBank)schA33
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)

close this sectionSequence

selected fasta
>hypothetical protein [putative secreted protein]
MCTSHEHDQTLCEAEQAGAGRRNVLRATALIGVATAAVALPAATTQAVPGSKARWRPDPD
SRRFTLAVMPDTQYLFDGPSIDKAPVEASLRYLLEHGRDENIVFLSHLGDLTQNGAKAEC
AAIGQAFRLLDRQGVGYSVLAGNHDVKSSTDDQRGPSPYLDVFGPDRFKGRSTYGGASPD
GYNTFHLFRAAGREWMVLALDWRLSAKGFAWAKDVIAQHPKTPVILTTHELVDEDDSLSS
YGQQLWDQLIEDHDQIFLTLNGHYWPAARATRKNAAGHDVHLHLTNYQNRYFGGAAMIRL
YRFDLDRNTVDVETVSPWILGRAAKGLNELERQESELSGDADRFSVGIDFEERFAGFAPV
PARPARPASKMLIPGTVAYWRFDGKSDGAAVTGTVRDVSGRGNDLSLVTVAGGTLTWSSD
HHPDQPGHGSLDFHGGKPPLKGAYLRTVDGAPLNSATFKAGYTIEAFYRLPADWDPSHDA
WAGLLGRTGTGGAAGKTADDPDEPIATLSLSNDREPQWAMRPLNQQGIATNWGQETPLET
WWHIAVVNDGRHTTLYVQGCPVVRNPKASSVGITSVGLPWILGGYEYAGKIDQILHGRLG
DVRIVERALPVTSFMNH
selected fasta
>hypothetical protein [putative secreted protein]
GTGTGTACTTCGCATGAGCACGACCAGACCCTCTGCGAGGCCGAGCAGGCCGGCGCCGGA
CGACGGAACGTCCTGCGGGCGACCGCGCTGATCGGGGTGGCCACGGCAGCGGTCGCGCTG
CCGGCGGCCACCACGCAGGCGGTGCCGGGCTCGAAGGCCCGTTGGAGACCCGACCCCGAC
AGCCGCCGCTTCACGCTCGCCGTGATGCCCGACACGCAGTACCTGTTCGACGGGCCCAGC
ATCGACAAGGCGCCCGTCGAGGCGTCCCTGCGCTATCTGCTGGAGCACGGGCGCGACGAG
AACATCGTGTTCCTGTCCCACCTCGGCGACCTGACGCAGAACGGCGCGAAGGCGGAGTGC
GCGGCGATCGGCCAGGCGTTCCGGCTGCTCGACCGGCAGGGCGTCGGCTACAGCGTCCTG
GCGGGCAACCACGACGTGAAGTCGTCGACGGACGACCAGCGCGGCCCGAGCCCGTACCTG
GACGTCTTCGGCCCGGACCGCTTCAAGGGCAGGTCCACGTACGGGGGTGCCTCCCCAGAC
GGGTACAACACCTTCCACCTCTTCCGGGCGGCCGGGCGGGAGTGGATGGTGCTCGCGCTG
GACTGGCGGCTGTCGGCGAAGGGCTTCGCGTGGGCCAAGGACGTCATCGCCCAGCACCCG
AAGACTCCGGTGATCCTCACGACGCACGAGCTGGTCGACGAGGACGACTCGCTCTCCTCG
TACGGACAGCAGTTGTGGGACCAGCTGATCGAGGACCACGACCAGATCTTCCTCACCCTC
AACGGCCACTACTGGCCCGCGGCGCGGGCAACTCGCAAGAACGCGGCGGGACATGACGTC
CACCTGCATCTGACGAACTATCAGAACCGGTACTTCGGCGGTGCGGCGATGATCCGGCTC
TACCGCTTCGACCTCGACCGGAACACCGTGGACGTGGAGACGGTGTCGCCGTGGATCCTC
GGCCGGGCCGCGAAGGGGCTCAACGAGCTGGAGCGCCAGGAGAGCGAACTCAGTGGTGAC
GCCGACCGGTTCTCGGTCGGGATCGACTTCGAGGAGCGCTTCGCCGGCTTCGCCCCGGTG
CCCGCGCGCCCGGCGCGTCCCGCGTCGAAGATGCTGATACCGGGCACGGTCGCGTACTGG
CGCTTCGACGGGAAGTCCGACGGGGCCGCCGTGACCGGCACGGTCCGCGATGTGTCCGGG
CGCGGCAACGACCTCTCCCTGGTCACGGTCGCGGGCGGCACGCTCACCTGGTCGTCGGAC
CACCACCCCGACCAACCGGGCCACGGCAGCCTGGACTTCCACGGCGGCAAGCCCCCGCTG
AAGGGCGCGTACCTGCGGACGGTCGACGGCGCGCCCCTCAACTCGGCCACTTTCAAGGCG
GGTTACACCATCGAGGCCTTCTACCGGCTGCCCGCCGACTGGGACCCCTCGCACGACGCG
TGGGCCGGGCTGCTCGGCCGCACCGGTACGGGCGGTGCCGCGGGGAAGACCGCCGACGAC
CCGGACGAACCCATCGCCACGCTGTCGCTGTCGAACGACCGCGAGCCCCAGTGGGCCATG
CGCCCCCTCAACCAGCAGGGAATCGCGACCAACTGGGGCCAGGAGACACCGTTGGAGACG
TGGTGGCACATCGCCGTCGTCAACGACGGAAGGCACACCACCCTGTATGTGCAGGGCTGC
CCGGTGGTGCGCAACCCGAAGGCGTCGTCCGTCGGCATCACCTCCGTCGGCCTGCCCTGG
ATCCTCGGCGGCTACGAGTACGCCGGGAAGATCGACCAGATCCTGCACGGACGGCTCGGT
GACGTGCGGATCGTCGAACGCGCCCTGCCCGTCACGTCGTTCATGAACCACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006311 Twin-arginine translocation pathway, signal sequence (Conserved_site)
 [1-47]  7.97 PS51318
PS51318   TAT
IPR008985 Concanavalin A-like lectin/glucanase (Domain)
 [362-609]  2.8e-19 SSF49899
SSF49899   Concanavalin A-like lectins/glucanases
IPR013320 Concanavalin A-like lectin/glucanase, subgroup (Domain)
 [371-609]  2.5e-11 G3DSA:2.60.120.200
G3DSA:2.60.120.200   no description
SignalP
 [1-39]  0.441 Signal
Bacteria, Gram-positive   
TMHMM No significant hit