close all open/close all
Sch475_00540 Sch475_00540   last last

CDS information : Sch475_00550


close this sectionLocation

Organism
StrainSCC-2136
Entry nameSch 47554
Contig
Start / Stop / Direction77,076 / 74,161 / - [in whole cluster]
77,076 / 74,161 / - [in contig]
Locationcomplement(74161..77076) [in whole cluster]
complement(74161..77076) [in contig]
TypeCDS
Length2,916 bp (971 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative beta-galactosidase
Product (GenBank)beta-galactosidae
Gene
Gene (GenBank)schA34
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[17085966] Angucyclines Sch 47554 and Sch 47555 from Streptomyces sp. SCC-2136: cloning, sequencing, and characterization. (Mol Cells. , 2006)
Related Reference
ACC
Q56307
PmId
[8088532] Identification and sequencing of the Thermotoga maritima lacZ gene, part of a divergently transcribed operon. (Gene. , 1994)
ACC
Q59140
PmId
[7811090] Characterization of a psychrotrophic Arthrobacter gene and its cold-active beta-galactosidase. (Appl Environ Microbiol. , 1994)
ACC
P00722
PmId
[1350782] Glu-537, not Glu-461, is the nucleophile in the active site of (lac Z) beta-galactosidase from Escherichia coli. (J Biol Chem. , 1992)
[11732897] A structural view of the action of Escherichia coli (lacZ) beta-galactosidase. (Biochemistry. , 2001)

close this sectionSequence

selected fasta
>putative beta-galactosidase [beta-galactosidae]
MRRDHLIALRPWEAPEVTSWGRLAMNAVDRRSGALSLDGSWHFQLLPSPMGCSGEWTRTE
VPGTWTTQSGDDLPQYTNAQMPWGEFPPASPAANPTGIYERSVDIPAEWAGRRIVLQVGA
AESVLLVHVNGKPVGISKDSHLAAEFDLSDVVRPGDPATVRFTVVKWSDASHIEDQDQWW
HAGITRSVLLYATDPLYLADVTVRARRDGRLRVDCQVRDATGPLPRGWYVTGALEGQLLA
QDTEFDRFNAEDMRVSDFLGEARLRGTVENVWPWTAETPELYDLTVRLHRADGTVADTSH
HRVGFRDVEIRGRDLLVNGERVYIRGVNRHDFHPLTGRTVTADDMRADLVVMKRFGFNAI
RTAHYPNDPTLYDLADELGFYVVDEANIESHDHAHEIADDPRYLPAFVDRVSRMVLRDKN
HPSVIIWSLGNESDYGANHDAAAGWVRRHDPTRPIQYEGAAKLDWADPTTASDIVCPMYA
PIEDCVAHARSGKQTMPLIQCEYSHAMGNSNGTLADTWAAIESTPGLQGGFIWEFWDHGI
LQRVNDGRPAGRGGAGLYEHGVAAPGHRWAYGGDFGETIHDGAFIADGVVFPDRTPKPVM
YEHREIAAPVRLTYDQGVLLVHNRQHFRDLEWLAAEWCLVLADGTTVTAPAELPDVLPGE
SAAVPLPFPVQEGESWLTLRVVTADDEAWAPLGTEVCLPQVRLGAAVAEATPEPASGPAV
TLDADALLVHPLLTSAPVLSLWRAPTDNDELGGMAARWHDWGLDELVRKVVDVREEGPRV
VVVAEYATGAGPVRHEQVFTPVAGGLRVEESAELPEGLDDVARVGTVFETVAGLDVLDWY
GQGPWESYPDRSTGAPVGHHSLPVDELFTPYLRPQESGGRHGVRRFTLSAPDATGLTVEL
GAPGQVSVNRYRAGDLAAAAHHDELVPRPGCVVHLDAAHRGLGTASCGPDTTAEYLVTPG
THRWAWTLRVL
selected fasta
>putative beta-galactosidase [beta-galactosidae]
ATGCGACGCGATCACCTGATCGCCCTGCGCCCCTGGGAGGCACCGGAGGTGACCTCCTGG
GGGCGGCTGGCCATGAACGCGGTGGACCGGCGCTCCGGTGCGCTGTCCCTGGACGGCTCC
TGGCACTTCCAGCTGCTGCCCTCGCCCATGGGCTGCTCGGGCGAGTGGACCCGGACCGAG
GTGCCGGGCACCTGGACCACCCAGAGCGGCGACGACCTGCCGCAGTACACCAACGCGCAG
ATGCCGTGGGGCGAATTCCCGCCCGCCTCGCCCGCCGCCAACCCGACGGGCATATACGAG
CGTTCCGTCGACATCCCCGCCGAGTGGGCCGGACGCCGGATCGTGCTCCAGGTCGGCGCG
GCCGAGAGCGTGCTCCTGGTCCATGTGAACGGCAAACCGGTCGGCATCTCCAAGGACTCC
CACCTCGCGGCCGAGTTCGACCTCTCCGACGTCGTACGCCCCGGTGACCCGGCGACCGTA
CGGTTCACCGTCGTCAAGTGGTCCGACGCCTCGCACATCGAGGACCAGGACCAGTGGTGG
CACGCCGGTATCACCCGCTCGGTGCTGCTGTACGCGACCGACCCGCTGTATCTCGCGGAC
GTGACCGTGCGGGCGCGGCGGGACGGGCGGCTCCGGGTCGACTGCCAGGTGCGCGACGCG
ACGGGACCGCTGCCGCGGGGGTGGTACGTCACCGGGGCGCTGGAGGGCCAACTCCTAGCC
CAGGACACCGAGTTCGACCGCTTCAACGCCGAGGACATGCGGGTGTCCGACTTCCTCGGT
GAGGCCCGGCTGCGGGGCACCGTCGAGAACGTATGGCCGTGGACCGCCGAGACACCCGAG
CTGTACGACCTGACCGTGCGCCTGCACCGGGCCGACGGTACGGTCGCCGACACCTCCCAC
CACCGGGTCGGGTTCCGGGACGTCGAGATCCGCGGCCGGGACCTGCTGGTCAACGGCGAA
CGCGTCTACATCCGGGGCGTCAACCGGCACGACTTCCACCCGCTGACCGGCCGCACGGTC
ACCGCGGACGACATGCGCGCGGACCTGGTCGTCATGAAGCGCTTCGGCTTCAACGCGATC
CGCACCGCCCACTACCCGAACGACCCGACGCTGTACGACCTCGCCGACGAGCTGGGCTTC
TATGTCGTGGACGAGGCGAACATCGAGTCGCACGACCACGCCCACGAGATCGCCGACGAC
CCCCGCTATCTGCCCGCCTTCGTGGACCGGGTCTCGCGCATGGTGCTGCGCGACAAGAAC
CACCCGTCGGTCATCATCTGGTCGCTCGGCAACGAGTCCGACTACGGAGCCAACCACGAC
GCGGCGGCGGGCTGGGTCCGGCGCCACGACCCGACCCGACCCATCCAGTACGAGGGCGCG
GCCAAGCTCGACTGGGCGGATCCGACGACCGCGTCCGACATCGTCTGCCCGATGTACGCG
CCGATCGAGGACTGTGTCGCGCACGCCCGGTCGGGGAAGCAGACCATGCCGCTCATCCAG
TGCGAGTACTCGCACGCCATGGGCAACAGCAACGGAACGCTCGCCGACACCTGGGCGGCC
ATCGAGTCCACCCCAGGTCTTCAGGGCGGCTTCATCTGGGAGTTCTGGGACCACGGCATT
CTCCAGCGTGTGAACGACGGAAGACCTGCCGGGCGTGGGGGCGCCGGGCTGTACGAGCAC
GGAGTCGCCGCGCCCGGCCATCGCTGGGCCTACGGCGGCGACTTCGGCGAGACCATCCAC
GACGGGGCGTTCATCGCCGACGGCGTGGTGTTCCCGGACCGCACGCCCAAGCCCGTGATG
TACGAGCACCGGGAGATCGCGGCACCGGTCCGCCTCACCTATGACCAGGGCGTGCTCCTG
GTCCACAACCGGCAGCACTTCCGGGACCTGGAATGGCTGGCCGCCGAGTGGTGCCTGGTC
CTCGCGGACGGCACCACGGTGACGGCACCGGCCGAGCTGCCCGACGTACTGCCGGGCGAG
TCCGCGGCGGTGCCACTGCCGTTCCCCGTGCAGGAGGGCGAGTCCTGGCTGACGCTGCGG
GTCGTCACCGCGGACGACGAGGCCTGGGCTCCCCTCGGCACCGAGGTGTGTCTGCCGCAG
GTCCGGCTGGGCGCGGCCGTCGCCGAGGCGACGCCGGAGCCCGCGTCCGGCCCGGCCGTC
ACGCTGGACGCGGACGCACTCCTGGTCCACCCGCTGCTGACCTCCGCGCCCGTCCTCTCG
CTGTGGCGGGCGCCCACCGACAACGACGAACTGGGCGGCATGGCGGCCCGCTGGCACGAC
TGGGGCCTCGACGAGCTCGTACGCAAGGTCGTGGACGTCCGTGAGGAGGGCCCTCGGGTC
GTCGTGGTCGCCGAGTACGCGACCGGGGCCGGGCCCGTCCGCCACGAGCAGGTGTTCACC
CCGGTCGCCGGCGGCCTCCGGGTCGAGGAGTCGGCCGAACTGCCGGAGGGCCTCGACGAC
GTGGCCCGCGTCGGCACGGTCTTCGAGACGGTCGCCGGGCTCGACGTCCTGGACTGGTAC
GGGCAGGGCCCCTGGGAGTCCTACCCGGACCGGAGCACGGGCGCGCCCGTCGGGCACCAC
TCGCTTCCGGTGGACGAGCTGTTCACCCCTTATCTGCGGCCTCAGGAGAGCGGCGGCCGG
CACGGTGTGCGGCGGTTCACGCTGTCGGCGCCGGACGCCACGGGGCTGACCGTGGAGCTC
GGGGCGCCGGGGCAGGTCTCCGTCAACCGGTACCGGGCCGGGGACCTGGCGGCTGCCGCG
CACCACGACGAGCTGGTGCCGCGGCCCGGCTGTGTCGTGCACCTCGACGCCGCGCACCGG
GGGCTCGGCACGGCGTCGTGCGGGCCCGACACCACCGCCGAGTACCTCGTCACGCCGGGC
ACGCACCGCTGGGCGTGGACGCTGCGCGTGCTCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004199 Beta galactosidase small chain/ domain 5 (Domain)
 [732-968]  3.7e-47 PF02929
PF02929   Bgal_small_N
 [702-969]  2.2999842048857e-81 SM01038
SM01038   Bgal_small_N
IPR006101 Glycoside hydrolase, family 2 (Family)
 [121-136]  8.40001703163685e-28 PR00132 [317-331]  8.40001703163685e-28 PR00132 [348-366]  8.40001703163685e-28 PR00132 [418-433]  8.40001703163685e-28 PR00132 [496-511]  8.40001703163685e-28 PR00132
PR00132   GLHYDRLASE2
IPR006102 Glycoside hydrolase, family 2, immunoglobulin-like beta-sandwich (Domain)
 [254-306]  9.50000000000001e-09 PF00703
PF00703   Glyco_hydro_2
 [196-307]  1.60000240695997e-17 SSF49303 [604-709]  6.69999687625999e-24 SSF49303
SSF49303   Glyco_hydro_2Ig
IPR006103 Glycoside hydrolase, family 2, TIM barrel (Domain)
 [308-610]  3.90000000000001e-88 PF02836
PF02836   Glyco_hydro_2_C
IPR006104 Glycoside hydrolase, family 2, N-terminal (Domain)
 [35-194]  2.99999999999998e-37 PF02837
PF02837   Glyco_hydro_2_N
IPR008979 Galactose-binding domain-like (Domain)
 [9-195]  9.60004130884281e-48 SSF49785
SSF49785   Gal_bind_like
IPR011013 Glycoside hydrolase-type carbohydrate-binding (Domain)
 [714-971]  3.99998544139406e-64 SSF74650
SSF74650   Gal_mut_like
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [308-606]  5.09999999999992e-91 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR013812 Glycoside hydrolase, family 2/20, immunoglobulin-like beta-sandwich domain (Domain)
 [184-306]  6.70000000000001e-15 G3DSA:2.60.40.320 [609-706]  2.5e-19 G3DSA:2.60.40.320
G3DSA:2.60.40.320   Glyco_hydro_2/20_Ig-like
IPR014718 Glycoside hydrolase-type carbohydrate-binding, subgroup (Domain)
 [731-970]  9.9e-64 G3DSA:2.70.98.10
G3DSA:2.70.98.10   Glyco_hydro_42_D5
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [308-606]  6.00001679190159e-86 SSF51445
SSF51445   Glyco_hydro_cat
IPR023230 Glycoside hydrolase, family 2, conserved site (Conserved_site)
 [358-383]  PS00719
PS00719   GLYCOSYL_HYDROL_F2_1
IPR023232 Glycoside hydrolase, family 2, active site (Active_site)
 [418-432]  PS00608
PS00608   GLYCOSYL_HYDROL_F2_2
SignalP No significant hit
TMHMM No significant hit
Sch475_00540 Sch475_00540   last last