close all open/close all
first first   Soraph_00020 Soraph_00020

CDS information : Soraph_00010


close this sectionLocation

Organism
StrainSo ce26
Entry nameSoraphen
Contig
Start / Stop / Direction57 / 986 / + [in whole cluster]
57 / 986 / + [in contig]
Location57..986 [in whole cluster]
57..986 [in contig]
TypeCDS
Length930 bp (309 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein(fragment)
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • hypothetical protein; Orf1
Reference
ACC
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)

close this sectionSequence

selected fasta
>hypothetical protein(fragment) [unknown]
MRADNPSSAGICDAIERYIEHGQVLAAGRYTLFHYLEEHGVSPALFRAAEAAFVEEVREG
TRAAFASLGEKSKRSPSPAQNAPAASSSLQLPITAPVDEPALNELCEIVRDCVAATSQGC
ERLAEMYHGQPVPLSVQEVWHEANELAQQCRPLLDGTFTHADHLRAWGVDPSMSAASPAV
PVSNTGSAAQCTEPPLLPPARQQAAQQRPEAPHSSEDTHTGPLKLLLAVARKEFGVMLGS
YGAHGLRERVEQEIRKTNWPEDVQEAVLQHFWSIAGKSAPAGPPLSDGLELSAPVPAARI
TRSPKWMRR
selected fasta
>hypothetical protein(fragment) [unknown]
ATGCGTGCCGACAATCCGTCGAGCGCCGGGATCTGCGATGCGATCGAGCGGTACATCGAG
CACGGCCAAGTCCTGGCTGCGGGGCGATACACGCTTTTCCACTACCTTGAGGAGCATGGC
GTATCCCCGGCGCTCTTTCGCGCCGCAGAGGCAGCCTTCGTCGAAGAAGTGAGGGAGGGC
ACGCGCGCCGCGTTCGCCTCCTTGGGTGAGAAGTCAAAGCGTTCGCCGAGCCCCGCTCAG
AACGCGCCCGCCGCAAGCAGTTCCCTCCAGTTGCCGATCACCGCGCCCGTCGACGAGCCC
GCGCTCAATGAGCTGTGCGAGATCGTTCGGGACTGCGTCGCGGCCACAAGTCAGGGCTGC
GAGAGGCTTGCCGAGATGTACCACGGGCAGCCCGTGCCGCTCAGCGTCCAGGAGGTCTGG
CACGAGGCCAACGAGCTGGCGCAGCAGTGCCGTCCGCTGCTTGACGGCACTTTCACTCAC
GCCGACCACTTGCGCGCCTGGGGCGTCGATCCGTCGATGTCTGCTGCCAGCCCGGCGGTG
CCGGTGAGCAACACGGGCAGCGCTGCGCAGTGCACCGAGCCGCCCCTGCTACCTCCAGCG
CGACAGCAGGCGGCGCAGCAGCGGCCAGAGGCACCACACTCCAGCGAAGACACGCACACC
GGACCGCTGAAGCTGCTCCTCGCCGTCGCGCGGAAAGAGTTCGGCGTGATGCTCGGTAGC
TACGGGGCGCATGGTCTGCGGGAGCGGGTCGAACAAGAGATCCGGAAGACGAACTGGCCG
GAGGACGTGCAGGAGGCCGTGCTCCAACATTTCTGGTCCATCGCAGGCAAGTCTGCGCCG
GCAGGGCCACCGCTATCCGACGGCCTCGAGCTGTCTGCCCCTGTGCCCGCCGCGCGGATC
ACGAGGTCCCCCAAGTGGATGCGTCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro No significant hit
SignalP No significant hit
TMHMM No significant hit
first first   Soraph_00020 Soraph_00020