close all open/close all

CDS information : Soraph_00025


close this sectionLocation

Organism
StrainSo ce26
Entry nameSoraphen
Contig
Start / Stop / Direction6,813 / 8,849 / + [in whole cluster]
6,813 / 8,849 / + [in contig]
Location6813..8849 [in whole cluster]
6813..8849 [in contig]
TypeCDS
Length2,037 bp (678 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
ProductRhs element Vgr family protein
Product (GenBank)
Gene
Gene (GenBank)
EC number
Keyword
Note
  • Orf3
Note (GenBank)
Reference
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
Related Reference
ACC
A8YQR5
PmId
[17986187] Dissection of a type VI secretion system in Edwardsiella tarda. (Mol Microbiol. , 2007)
Family/Domain
FD
IPR017847

close this sectionSequence

selected fasta
>Rhs element Vgr family protein
MMDGTLSHVLLAGSGLPGDVRVQSYEAHEAVSLPYAVHVELATSDPSFRIDECLQRRMVL
EVGDGQGGVRYYDGLPDRVGFLAYRGGEFFFRMRLRPALAALEHREGSRIFQDKTPVDVV
KTILAEAGVDTDVEWRLRQTYAPREFLCQYRETEMNFVHRILEDEGIFYFFLHSPDGHKL
VFCDDPAAFAQEEGTPPVVLAPRQGGVAGTQPLLEFRREKTLRATEVVLRDYDFEKPELP
PTATTPAPGPWSIRHFQYPGGFTSSAEGSRRSRGRISSLRGDVDVCRGRSRAAGLRCGAP
MTVEGANEPFLNGEFVAVELRSRGRSGEDACENEFAAVPKGAPFAAPLRAKKPRIRGIQT
AVVTGPSNEPQSIHVDAKYLAIAVAESAPGSRRSRRRPASMHSISEACRSVNMSLIIRRT
SWCSFSGAPNCSRRLVYATQASTHARRMPTQPHATVYRPRSSATEATCVMPKPRRPTTWS
ASTRHPSRCTLAVIDARMPSRSRIGSVRRPGRPRSTRTAVGPSSVRPKTRKRSAISPYVI
HLFSPSITRSVPWAAIRVVTLLASLPTPGSDSASAPIRRPDASSGSHRSRCARVPHRRIA
SATIVWTVSRLRTDEQPRASSAARSPSVTASSPAPPNSLGMEMPRYPRSARSAMSSGGVR
WARWNASANGATCSSTKP
selected fasta
>Rhs element Vgr family protein
ATGATGGATGGCACGCTCAGCCACGTGCTCCTTGCGGGCAGCGGTCTGCCCGGCGACGTA
CGGGTCCAGTCCTACGAGGCGCACGAGGCGGTGTCGCTGCCGTACGCGGTCCACGTTGAG
CTCGCGACCAGCGACCCGTCGTTCCGCATCGACGAGTGCCTCCAGCGCCGGATGGTGCTC
GAGGTCGGGGACGGACAGGGGGGCGTCCGATACTACGACGGCCTCCCGGACCGCGTCGGC
TTCCTCGCGTACCGAGGTGGCGAGTTCTTCTTTCGCATGCGACTCCGCCCCGCGTTGGCC
GCGCTCGAGCACCGCGAGGGATCGCGCATCTTCCAGGACAAGACCCCGGTCGACGTCGTC
AAGACCATCCTGGCCGAGGCCGGCGTCGACACGGACGTGGAATGGCGGCTCCGGCAGACC
TACGCCCCGCGCGAGTTTCTCTGCCAGTACCGCGAGACGGAGATGAACTTCGTCCACCGC
ATCCTCGAGGACGAGGGCATCTTCTACTTCTTTCTCCACTCGCCCGACGGCCACAAGCTT
GTCTTCTGCGACGACCCCGCCGCCTTCGCGCAGGAAGAGGGCACCCCGCCCGTCGTGCTC
GCGCCGCGCCAGGGCGGGGTCGCGGGGACACAGCCCCTTCTTGAATTCCGCCGCGAGAAG
ACGCTGCGCGCTACCGAGGTGGTGCTGCGCGACTACGACTTCGAGAAGCCCGAGCTACCC
CCTACGGCGACGACCCCCGCACCAGGTCCGTGGTCCATCCGCCACTTCCAATACCCGGGC
GGCTTCACCTCGAGCGCCGAGGGATCGCGCCGGTCGCGGGGCCGTATCAGCTCGCTGCGC
GGTGACGTGGACGTCTGCCGCGGGAGGAGCCGCGCGGCAGGCCTCCGCTGCGGCGCGCCG
ATGACGGTCGAGGGGGCCAACGAGCCGTTCCTGAATGGCGAGTTCGTCGCGGTAGAGCTG
CGATCGCGAGGTCGCAGCGGCGAGGATGCGTGCGAGAACGAGTTCGCCGCCGTCCCCAAG
GGCGCGCCCTTCGCCGCGCCCCTGCGCGCGAAGAAGCCCAGGATCCGCGGCATCCAGACG
GCCGTCGTGACGGGCCCCTCGAACGAGCCCCAGTCGATCCACGTCGACGCGAAGTACTTG
GCCATCGCCGTCGCCGAGAGCGCGCCGGGATCTCGGCGGTCACGCAGGCGGCCGGCCTCC
ATGCACAGCATCTCCGAGGCGTGCAGGTCCGTGAACATGTCGCTGATCATCCGCCGGACG
AGCTGGTGCTCCTTCAGCGGCGCGCCGAATTGCTCGCGGCGGCTCGTGTACGCGACGCAG
GCCTCGACGCACGCCCGGAGGATGCCCACGCAGCCCCACGCGACGGTGTACCGGCCCAGA
TCGAGCGCGACGGAGGCGACCTGCGTGATGCCCAAACCTCGCCGCCCCACCACGTGGTCG
GCCTCCACGCGGCATCCATCGAGATGCACGCTCGCGGTCATCGACGCGCGGATGCCCAGC
AGATCGCGGATCGGCTCGGTCCGGAGGCCCGGCCGACCGCGCTCGACGAGGACAGCCGTG
GGCCCTTCCTCGGTGCGCCCGAAGACGAGGAAGAGGTCGGCGATCTCGCCGTACGTGATC
CACCTCTTCTCGCCGTCGATCACGAGATCGGTCCCCTGGGCGGCGATCCGCGTCGTGACG
CTCTTGGCGTCGCTGCCGACGCCCGGCTCGGACAGCGCGAGCGCCCCGATCCGGCGACCC
GACGCGAGCTCCGGCAGCCACCGTTCTCGCTGCGCGCGGGTGCCCCACCGGAGGATCGCC
AGCGCCACCATCGTGTGGACGGTGAGCAGGCTGCGCACCGACGAGCAGCCGCGGGCGAGC
TCCGCCGCGAGGAGCCCGAGCGTCACGGCGTCCTCGCCGGCACCCCCGAACTCTTTGGGG
ATGGAGATGCCGAGGTACCCGCGCTCGGCGAGGAGCGCGATGAGCTCCGGCGGCGTCCGC
TGGGCCCGGTGGAACGCGTCGGCGAACGGCGCGACGTGCTCGTCGACGAAACCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR006533 Rhs element Vgr protein (Family)
 [21-377]  5.2e-50 TIGR01646
TIGR01646   vgr_GE: Rhs element Vgr protein
IPR017847 Type VI secretion system, Rhs element Vgr family (Family)
 [19-377]  2e-76 TIGR03361
TIGR03361   VI_Rhs_Vgr: type VI secretion system Vgr family pr
SignalP No significant hit
TMHMM No significant hit