close all open/close all

CDS information : Soraph_00035


close this sectionLocation

Organism
StrainSo ce26
Entry nameSoraphen
Contig
Start / Stop / Direction9,181 / 8,930 / - [in whole cluster]
9,181 / 8,930 / - [in contig]
Locationcomplement(8930..9181) [in whole cluster]
complement(8930..9181) [in contig]
TypeCDS
Length252 bp (83 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.1 modification addition of extender units
Productputative acyl carrier protein
Product (GenBank)
GenesorF
Gene (GenBank)
EC number
Keyword
  • methoxymalonyl-ACP
Note
Note (GenBank)
Reference
PmId
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)
Related Reference
ACC
Q9XBU6
PmId
[16983083] Hydroxymalonyl-acyl carrier protein (ACP) and aminomalonyl-ACP are two additional type I polyketide synthase extender units. (Proc Natl Acad Sci U S A. , 2006)

close this sectionSequence

selected fasta
>putative acyl carrier protein
MSEAQMKQKIKTYLAKFFPGHELADDEDIFKLGFVNSMFALQLVNFVEHEFGIVVENEDM
ELDNFRSIRSLLGFVERKVSVPA
selected fasta
>putative acyl carrier protein
ATGAGCGAAGCGCAAATGAAGCAGAAGATCAAGACGTATCTCGCCAAGTTCTTCCCGGGT
CACGAGCTCGCGGACGACGAGGACATCTTCAAGCTCGGGTTCGTCAACTCGATGTTCGCG
CTCCAGCTGGTTAACTTCGTGGAGCACGAGTTCGGCATCGTCGTCGAGAACGAGGACATG
GAGCTCGACAACTTCCGCTCCATCCGGAGCCTGCTCGGGTTCGTCGAGCGCAAGGTCTCG
GTGCCGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR009081 Acyl carrier protein-like (Domain)
 [8-75]  8.4e-07 PF00550
PF00550   PP-binding
 [4-78]  1.1e-12 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   no description
 [2-79]  7.3e-11 SSF47336
SSF47336   ACP-like
SignalP
 [1-24]  0.141 Signal
Bacteria, Gram-negative   
TMHMM No significant hit