close all open/close all

CDS information : Soraph_00060


close this sectionLocation

Organism
StrainSo ce26
Entry nameSoraphen
Contig
Start / Stop / Direction13,697 / 14,158 / + [in whole cluster]
13,697 / 14,158 / + [in contig]
Location13697..14158 [in whole cluster]
13697..14158 [in contig]
TypeCDS
Length462 bp (153 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.3 modification reduction
Productputative oxidoreductase
Product (GenBank)reductase
Gene
Gene (GenBank)sorR
EC number
Keyword
Note
Note (GenBank)
Reference
ACC
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)
Family/Domain
FD
IPR013968

close this sectionSequence

selected fasta
>putative oxidoreductase [reductase]
MSVIHHFFTRPTPIRDAPDTYPSSERASMLAQVRSGCTPMVVGVDAFLLFSSSAGVLGSG
LQGAYSAANAFLDVLSEQPRVLGRSATSIAWCIWNGGGIVDHAGKEHLRRRGVSVMPLDL
ALAASYREESRGGSPQRSSPSLCSPVPSSRCPG
selected fasta
>putative oxidoreductase [reductase]
ATGAGTGTAATTCACCATTTCTTCACGCGCCCGACACCTATCCGAGACGCGCCCGACACC
TATCCGAGCTCGGAAAGAGCGTCCATGCTCGCGCAGGTTCGATCAGGCTGCACGCCCATG
GTGGTCGGTGTAGACGCCTTCCTCCTCTTCTCCTCGAGTGCAGGTGTCTTGGGGAGCGGG
CTGCAGGGCGCCTACTCGGCGGCCAACGCTTTCCTGGACGTGCTGTCCGAGCAGCCTCGC
GTCCTCGGACGGTCGGCCACGTCGATTGCCTGGTGCATATGGAACGGCGGAGGTATTGTC
GACCACGCAGGCAAAGAGCATCTCAGAAGACGTGGCGTGTCCGTGATGCCGCTAGATCTC
GCCCTCGCGGCCTCGTATCGTGAGGAATCCAGGGGTGGGAGCCCGCAAAGATCCTCACCC
TCACTCTGCTCGCCCGTGCCATCGAGCCGTTGTCCGGGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013968 Polyketide synthase, KR (Domain)
 [44-96]  1.7e-15 PF08659
PF08659   KR
IPR016040 NAD(P)-binding domain (Domain)
 [47-101]  8.69999999999999e-06 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-16]  0.253 Signal
Bacteria, Gram-negative   
TMHMM No significant hit