close all open/close all

CDS information : Soraph_00090


close this sectionLocation

Organism
StrainSo ce26
Entry nameSoraphen
Contig
Start / Stop / Direction59,795 / 60,226 / + [in whole cluster]
59,795 / 60,226 / + [in contig]
Location59795..60226 [in whole cluster]
59795..60226 [in contig]
TypeCDS
Length432 bp (143 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • similar to hypothetical protein MmyY from Streptomyces coelicolor; Orf4
Reference
ACC
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MDPKRIQSVIERIEIIDTLTTFTRAADMREWDTCRAILGETIINDHGTPETLSRDALIER
WRVQSPTLDLIHHVTTDHLVVIDGDLAKVHTQFIITVRATGAPSGDLCTRGGSCDYDLKR
TDEGWKLTGFKSVIQWSMGSVNI
selected fasta
>hypothetical protein [unknown]
ATGGACCCGAAACGAATCCAATCCGTCATTGAACGCATCGAAATCATCGACACGCTCACC
ACCTTCACCCGCGCAGCAGACATGCGTGAATGGGATACGTGTCGGGCCATCCTCGGAGAG
ACGATCATCAACGATCACGGCACGCCCGAGACTCTCTCTCGCGACGCGCTCATCGAGCGG
TGGCGTGTACAGTCGCCCACGCTCGACCTGATCCATCACGTGACCACGGATCATCTCGTC
GTGATCGATGGCGACCTCGCGAAGGTCCACACCCAGTTCATTATCACGGTGCGCGCGACG
GGCGCGCCGAGCGGCGATCTGTGCACGCGCGGCGGCTCCTGCGATTACGATCTGAAGCGG
ACCGATGAAGGCTGGAAGCTCACGGGCTTCAAGTCGGTCATCCAGTGGAGCATGGGGAGC
GTGAACATCTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-25]  0.046 Signal
Bacteria, Gram-negative   
 [1-25]  0.109 Signal
Eukaryota   
TMHMM No significant hit