close all open/close all

CDS information : Soraph_00100


close this sectionLocation

Organism
StrainSo ce26
Entry nameSoraphen
Contig
Start / Stop / Direction60,255 / 61,295 / + [in whole cluster]
60,255 / 61,295 / + [in contig]
Location60255..61295 [in whole cluster]
60255..61295 [in contig]
TypeCDS
Length1,041 bp (346 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.2 modification methylation
Productputative O-methyltransferase
Product (GenBank)O-methyltransferase
Gene
Gene (GenBank)sorM
EC number2.1.1.-
Keyword
  • C-11
Note
Note (GenBank)
Reference
ACC
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)
Related Reference
ACC
Q54303
NITE
Rapam_00180
PmId
[11372782] Deletion of rapQONML from the rapamycin gene cluster of Streptomyces hygroscopicus gives production of the 16-O-desmethyl-27-desmethoxy analog. (J Antibiot (Tokyo). , 2001)
[16990929] Rapamycin biosynthesis: Elucidation of gene product function. (Org Biomol Chem. , 2006)

close this sectionSequence

selected fasta
>putative O-methyltransferase [O-methyltransferase]
MQISPGARTSPITADSKRGSNMASQQIELIKMFKRMVDAMASIQSAVDQDALAAQGGTLK
RLIEDGYNLEAAQGADRFHNWGMFHEEVYRDVLQQLPDYDKSDTDGYSEQLYVYTLKQVP
ADEDRPRKILEVGCNTGKGLNFLSRIEGRSTFVGLDLSQQAVDIANARFSRPGSLTYVQG
DAENLPFADGEFDVVINVESSHNYPNLRKSFLEVARVLRPGGFFSHVDVFSDNRYSVMQN
CKQQTSGELDWLKETDISEYVKEAIRRRLAPGSKARQQVERALPYPLGRLFSSVMMRGYG
SEFAVGQKSDDWIRNVSWLNPPGQQWLSQITSYRHTLATKARGHGS
selected fasta
>putative O-methyltransferase [O-methyltransferase]
ATGCAAATTTCGCCAGGGGCTCGGACATCTCCCATCACGGCGGATAGCAAACGAGGAAGC
AATATGGCATCGCAGCAGATCGAGCTGATCAAAATGTTCAAACGGATGGTGGACGCCATG
GCCAGCATCCAGTCCGCTGTCGACCAGGACGCGCTCGCCGCTCAAGGTGGCACGCTCAAG
CGCCTCATCGAGGACGGCTACAACCTCGAGGCCGCTCAAGGTGCCGATCGCTTTCACAAC
TGGGGGATGTTTCACGAGGAGGTTTATCGTGATGTTCTTCAACAGCTGCCAGATTACGAC
AAGAGCGACACAGACGGTTATTCGGAGCAGCTCTACGTCTACACGCTGAAGCAAGTTCCG
GCCGACGAAGATCGGCCACGCAAGATCCTGGAGGTCGGCTGCAACACTGGGAAGGGCCTC
AACTTCCTTTCCCGGATCGAGGGTCGCAGCACCTTCGTCGGGCTCGACCTGTCGCAGCAA
GCGGTGGACATCGCCAACGCCCGGTTCTCGCGACCGGGCTCGTTGACCTACGTTCAAGGC
GACGCGGAGAACCTTCCTTTCGCCGACGGCGAATTCGACGTCGTCATCAATGTCGAGAGC
TCGCACAACTACCCTAATCTGCGCAAATCATTCCTCGAAGTGGCGCGCGTGCTGCGACCG
GGCGGGTTCTTTTCGCATGTGGATGTCTTCTCGGACAATCGCTATTCGGTGATGCAGAAT
TGCAAGCAGCAGACCAGCGGCGAGCTCGACTGGCTCAAGGAGACCGACATCTCGGAGTAC
GTAAAAGAGGCTATCCGGCGACGACTGGCGCCCGGCAGCAAGGCAAGGCAACAGGTGGAG
CGCGCGCTGCCGTACCCGCTCGGAAGGCTTTTCAGCTCGGTCATGATGCGCGGCTACGGA
TCCGAGTTTGCCGTCGGACAGAAGTCGGACGACTGGATCAGGAATGTCTCATGGCTCAAC
CCTCCCGGCCAGCAATGGTTGTCGCAGATCACCTCGTATCGCCACACGCTCGCTACGAAG
GCGCGCGGCCACGGGTCTTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [130-224]  5.00000000000001e-21 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit