close all open/close all

CDS information : Soraph_00110


close this sectionLocation

Organism
StrainSo ce26
Entry nameSoraphen
Contig
Start / Stop / Direction63,353 / 61,362 / - [in whole cluster]
63,353 / 61,362 / - [in contig]
Locationcomplement(61362..63353) [in whole cluster]
complement(61362..63353) [in contig]
TypeCDS
Length1,992 bp (663 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative polysaccharide lyase
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • similar to hypothetical protein YesW from Bacillus subtilis; Orf5
Reference
ACC
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)
Related Reference
ACC
O31526
PmId
[16682770] Crystallization and preliminary X-ray analysis of the rhamnogalacturonan lyase YesW from Bacillus subtilis strain 168, a member of polysaccharide lyase family 11. (Acta Crystallogr Sect F Struct Biol Cryst Commun. , 2006)
[17449691] Plant cell wall degradation by saprophytic Bacillus subtilis strains: gene clusters responsible for rhamnogalacturonan depolymerization. (Appl Environ Microbiol. , 2007)

close this sectionSequence

selected fasta
>putative polysaccharide lyase [unknown]
MKRSVFLICFSLAAGLQACGSSDTGSSGADNTGGSGGDGAGTSGAGAGTPAGGGGAGTPS
GSSGSGGGGETAGPTGFAQMEDLDRGVVAVSTGDGIYVGWRLFGYDPDDIAFNVYRDGAK
VNDAPIADSTNLMDQDGSPGAVYTVRAVVGGVEQGASEGASVWRDGALSIPTEAPPAGDG
YTYSSGDGSVGDLDGDGRYEIIVKWDPSNLKDNSQAGRTGKTYLDAYSLEGERLWRIDLG
VNIRAGAHYSPFLVYDLDGDGKAEVAVKTAPGTRDGTGEPLSKGPAANDDDSRDYRNNDG
YILTGPEYLTVFSGETGAELATTDFVVGRGDPCSWGNNECYGNRVDRFVGTVAFLDDTGR
PSVVFGRGYYARTTLSAWNYRDGALTNLWTFDSSSSRDNGAYAGMGTHSISVANVDDDPQ
QEIINGGATFDNDGKGLCAVDYYGHGDALHVTDHILSRPGLEVFQPYEGGDSPAYAMRDA
RTCEVLWRGPGNGGEEGPGRGVAADVDPRNPGSEAWVNSSQLLSGADGDAIGNRPASSNF
LIWWDADLSRELLDGNSIRQADGEGSNFAAEGCTANNGSKSNPTLSADILGDWREEVIFR
CGSSIRIFTTNRVATSRIHTLMHDPQYRVAISWQNGAYNQPPHPSFHIGEGMAPVPKPDI
HVR
selected fasta
>putative polysaccharide lyase [unknown]
ATGAAACGATCGGTCTTCTTGATCTGCTTTTCTCTCGCCGCCGGGCTCCAGGCGTGCGGG
TCGAGTGATACGGGCTCCAGCGGAGCCGACAACACGGGCGGCTCGGGCGGGGACGGCGCC
GGCACGAGCGGCGCGGGCGCGGGCACGCCCGCCGGCGGCGGCGGCGCGGGTACACCTTCC
GGCAGCAGCGGCAGCGGCGGCGGCGGCGAGACGGCCGGGCCGACGGGGTTCGCCCAGATG
GAGGACCTCGACCGCGGCGTCGTGGCCGTCTCCACGGGCGACGGCATCTACGTGGGCTGG
CGCCTGTTCGGCTACGATCCCGACGACATCGCCTTCAACGTCTACCGCGACGGGGCCAAG
GTCAACGACGCTCCGATCGCGGACTCGACGAACCTCATGGACCAGGACGGCAGTCCGGGC
GCGGTCTACACGGTGCGCGCCGTCGTCGGCGGGGTCGAGCAAGGGGCGTCGGAGGGCGCG
TCCGTGTGGAGGGACGGGGCCCTGTCGATCCCGACCGAGGCGCCGCCCGCTGGGGACGGC
TACACGTACTCGAGCGGCGATGGCAGCGTGGGAGATCTGGACGGCGACGGGCGGTACGAG
ATCATCGTCAAGTGGGACCCGTCGAACCTCAAGGACAACTCGCAGGCTGGCCGCACCGGC
AAGACGTACCTCGACGCCTACTCGCTCGAGGGCGAGCGGCTCTGGCGCATCGACCTCGGC
GTGAACATCCGGGCCGGAGCGCACTACTCGCCGTTCCTCGTCTACGATCTCGACGGCGAC
GGGAAGGCGGAGGTGGCCGTCAAGACGGCGCCGGGGACACGCGACGGCACGGGCGAGCCC
CTCAGCAAGGGGCCCGCGGCGAACGACGACGACAGCCGGGACTACCGCAACAACGACGGC
TACATCCTGACCGGCCCGGAGTACCTCACCGTGTTCTCCGGGGAGACCGGCGCCGAGCTC
GCGACGACCGACTTCGTGGTGGGGCGCGGCGACCCGTGCAGCTGGGGCAACAACGAGTGT
TACGGCAATCGCGTCGACCGCTTCGTCGGCACGGTCGCGTTCCTCGACGACACCGGTCGT
CCGAGCGTGGTGTTCGGCCGCGGCTACTACGCGCGCACCACGCTGTCGGCGTGGAACTAC
CGCGACGGCGCGCTCACGAACCTCTGGACGTTCGACTCCAGCTCGAGCCGCGACAACGGG
GCGTACGCCGGCATGGGCACCCACTCCATCAGCGTCGCCAACGTGGATGACGATCCGCAG
CAGGAGATCATCAACGGGGGCGCCACGTTCGACAACGACGGCAAGGGCCTGTGCGCCGTG
GACTACTACGGTCACGGCGACGCGCTGCACGTCACGGATCACATCCTGTCGCGCCCCGGC
CTCGAGGTGTTCCAGCCGTACGAGGGCGGGGACTCACCCGCCTATGCCATGCGCGACGCG
CGCACGTGCGAGGTCCTCTGGCGGGGGCCGGGCAACGGCGGCGAGGAGGGCCCCGGCCGC
GGCGTGGCGGCCGACGTCGATCCGCGCAACCCGGGCAGCGAGGCGTGGGTCAATAGCAGC
CAGCTCCTGAGCGGCGCGGACGGCGACGCCATCGGGAACCGCCCCGCGTCGTCCAACTTC
CTCATCTGGTGGGACGCGGATCTGAGCCGGGAGCTGCTCGACGGCAACAGCATCCGCCAG
GCCGACGGCGAGGGAAGCAACTTCGCGGCCGAGGGCTGCACCGCGAACAACGGCTCGAAG
AGCAACCCGACCCTCAGCGCCGATATCCTCGGCGACTGGCGCGAAGAGGTGATCTTCCGC
TGCGGCAGCTCGATTCGTATCTTCACCACGAACCGCGTCGCCACGAGCCGGATCCACACC
CTGATGCACGATCCGCAGTACCGCGTGGCCATCTCGTGGCAGAACGGCGCCTACAACCAG
CCGCCTCACCCGAGCTTCCACATCGGGGAGGGGATGGCGCCGGTCCCGAAGCCGGACATC
CACGTCCGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-28]  0.999 Signal
Bacteria, Gram-positive   
 [1-20]  0.999 Signal
Bacteria, Gram-negative   
 [1-21]  1 Signal
Eukaryota   
TMHMM No significant hit