close all open/close all

CDS information : Soraph_00120


close this sectionLocation

Organism
StrainSo ce26
Entry nameSoraphen
Contig
Start / Stop / Direction63,970 / 65,478 / + [in whole cluster]
63,970 / 65,478 / + [in contig]
Location63970..65478 [in whole cluster]
63970..65478 [in contig]
TypeCDS
Length1,509 bp (502 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative glycosidase
Product (GenBank)beta-mannanase
Gene
Gene (GenBank)
EC number3.2.1.-
Keyword
Note
Note (GenBank)
  • Orf6
Reference
ACC
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)
Related Reference
ACC
O30654
PmId
[10525841] Sequencing and expression of a beta-mannanase gene from the extreme thermophile Dictyoglomus thermophilum Rt46B.1, and characteristics of the recombinant enzyme. (Curr Microbiol. , 1999)

close this sectionSequence

selected fasta
>putative glycosidase [beta-mannanase]
MRTSAWSYVSLSIALMGPAGCVVEADADLDAEVDELAGDLSTSTTYTLVGVQSGRCVDVP
GRSTADDIALNLWDCSGGTNQQFRFEAVSGGYYRIRNVNSNKCLDVRGASTADGAAIVQY
TCHNNTNQQWTVTDLGSDKVRITSRLSGKVIDAYGSPPENGTALFQWPSSGGTNQQFTLR
AVGTGTGTGTGTGTGTGTTDPTGPAPVSPSASPQARRLLSYIYSVYGNHILSGQHESTWV
GGPEYEMNYIHDRTGKYPAIRGLDFGDSGTSAASRAIAWWNAGGIPMIGYHMGAPTKPDG
YAGSQMTVSINAVLTSGTAENRSFHQRLDFAAGELQKLEDANVAVLWRPFHEAGGTWFWW
SKEGGAQYVRLWRYMFNYFTRDKGLTNLVWLHPYSGDPQASFYPGKEFVDITGADTYVSD
HNPLKAMFDRVRGIAGTTIPIALHENGPIPDPDQLEAQGARWVLFNTWHTDWLTGGSNPD
DFLRKVYGHRYVVTRDEVPNLR
selected fasta
>putative glycosidase [beta-mannanase]
ATGCGCACCTCCGCTTGGTCTTACGTTTCCCTGTCGATCGCGCTCATGGGCCCCGCCGGC
TGCGTCGTGGAGGCCGACGCCGACCTCGACGCGGAGGTCGACGAGCTCGCGGGCGACCTC
TCGACGAGCACCACCTACACCCTGGTCGGCGTCCAGAGCGGGCGCTGCGTCGACGTCCCA
GGCCGCTCCACGGCGGACGATATCGCGTTGAATCTCTGGGACTGCAGCGGCGGGACGAAC
CAGCAGTTCCGCTTCGAGGCGGTCTCCGGCGGCTATTACCGGATCCGCAACGTGAACAGC
AACAAGTGCCTCGACGTCCGCGGCGCGTCGACCGCCGACGGTGCCGCCATCGTCCAGTAC
ACCTGCCATAACAACACGAACCAGCAGTGGACCGTCACCGACCTCGGCAGCGACAAGGTC
CGCATCACCTCGCGCCTGAGCGGCAAGGTCATCGACGCGTACGGCTCCCCGCCCGAAAAC
GGCACCGCGCTGTTCCAGTGGCCCTCCAGCGGCGGCACGAACCAGCAGTTCACGCTGCGC
GCGGTGGGCACAGGTACCGGAACCGGAACCGGAACCGGTACAGGCACCGGAACCACCGAC
CCCACCGGGCCCGCGCCCGTGTCGCCCAGCGCCTCTCCGCAGGCGAGGCGGTTGCTCAGC
TACATCTACAGCGTGTACGGCAACCACATCCTCTCGGGGCAGCATGAGTCCACCTGGGTC
GGCGGGCCCGAGTACGAGATGAACTACATCCACGACCGCACGGGCAAATACCCCGCGATC
CGCGGCCTCGATTTCGGGGACTCCGGGACGTCCGCCGCCAGCCGCGCCATCGCCTGGTGG
AACGCGGGCGGCATTCCCATGATCGGCTACCACATGGGGGCGCCGACGAAGCCCGACGGC
TACGCCGGGTCCCAGATGACGGTGTCCATCAACGCCGTGCTCACGTCGGGGACGGCGGAG
AACCGATCGTTCCACCAGCGGCTCGACTTCGCCGCGGGCGAGCTGCAGAAGCTCGAGGAC
GCCAACGTGGCCGTGTTGTGGAGGCCGTTCCACGAGGCGGGCGGCACCTGGTTCTGGTGG
AGCAAGGAGGGCGGCGCGCAGTACGTCCGGCTGTGGAGGTACATGTTCAACTACTTCACC
CGGGACAAGGGCCTCACCAACCTGGTCTGGCTGCACCCCTATAGCGGCGACCCCCAGGCG
TCGTTCTACCCGGGCAAGGAGTTCGTCGACATCACCGGCGCGGACACGTATGTCAGCGAC
CACAACCCGCTGAAGGCGATGTTCGACAGGGTGCGCGGCATCGCGGGGACGACCATCCCC
ATCGCGCTCCACGAGAACGGACCCATCCCGGATCCCGATCAGCTGGAGGCCCAGGGCGCC
CGCTGGGTCCTCTTCAACACCTGGCACACCGACTGGTTGACCGGGGGGAGCAACCCGGAC
GACTTCCTGCGGAAGGTCTACGGCCACCGCTACGTCGTCACGCGCGACGAGGTGCCGAAC
CTGAGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000772 Ricin B lectin domain (Domain)
 [43-177]  2.8e-25 PF00652
PF00652   Ricin_B_lectin
 [42-180]  PS50231
PS50231   RICIN_B_LECTIN
 [41-179]  1.49999648196323e-40 SSF50370
SSF50370   RicinB_like
 [43-180]  3.00000067992871e-27 SM00458
SM00458   RICIN
IPR000805 Glycoside hydrolase, family 26 (Family)
 [278-292]  2.10000267834031e-18 PR00739 [344-361]  2.10000267834031e-18 PR00739 [371-394]  2.10000267834031e-18 PR00739 [405-417]  2.10000267834031e-18 PR00739
PR00739   GLHYDRLASE26
IPR013781 Glycoside hydrolase, catalytic domain (Domain)
 [205-501]  5.90000000000008e-79 G3DSA:3.20.20.80
G3DSA:3.20.20.80   Glyco_hydro_cat
IPR017853 Glycoside hydrolase, superfamily (Domain)
 [204-495]  1.3000049540733e-58 SSF51445
SSF51445   Glyco_hydro_cat
IPR022790 Endoglucanase H/Glycosyl hydrolase family 26 (Family)
 [207-497]  1.69999999999998e-69 PF02156
PF02156   Glyco_hydro_26
SignalP
 [1-25]  0.931 Signal
Bacteria, Gram-positive   
 [1-24]  0.953 Signal
Bacteria, Gram-negative   
 [1-21]  0.976 Signal
Eukaryota   
TMHMM No significant hit