close all open/close all
Soraph_00120 Soraph_00120   last last

CDS information : Soraph_00130


close this sectionLocation

Organism
StrainSo ce26
Entry nameSoraphen
Contig
Start / Stop / Direction65,934 / 66,941 / + [in whole cluster]
65,934 / 66,941 / + [in contig]
Location65934..66941 [in whole cluster]
65934..66941 [in contig]
TypeCDS
Length1,008 bp (335 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)xylanse-arabinofuranosidase bifunctional enzyme
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • Orf7
Reference
ACC
PmId
[12039053] Characterization of the biosynthetic gene cluster for the antifungal polyketide soraphen A from Sorangium cellulosum So ce26. (Gene. , 2002)
[15289572] Heterologous production of the antifungal polyketide antibiotic soraphen A of Sorangium cellulosum So ce26 in Streptomyces lividans. (Microbiology. , 2004)

close this sectionSequence

selected fasta
>hypothetical protein [xylanse-arabinofuranosidase bifunctional enzyme]
MTVGEFPNATPSWTVSAWVRVLTDQPPAEDTLRTVISTENTGGWELNIDYAGEAPGMHFA
FWKGPEISDYHSALCFCLELQRWTHAAGVVDGEALTMSLYIDGRLYSTMPIEKTISPGPT
SLYVGRWPQEGRLLVGDVDDIAIYSRALAAAEVAELSQHAVPAEVEADISTDTTYTLVGV
QSGLCVDVDAAVITADDVVLQLWDCNGGTNQQFRFEAVDGGYYRIRNVQSDKCLDVRSAS
TADGAAIVQYTCHDNANQQWSVTEAGDGAVRITSRLSGRVIDAYGSPPASGTALVQRASS
GGTSQQFKLTPLETGTGTGGTGGTGGTGGTGGTGP
selected fasta
>hypothetical protein [xylanse-arabinofuranosidase bifunctional enzyme]
ATGACGGTCGGCGAGTTCCCGAACGCCACCCCGAGCTGGACCGTCTCGGCGTGGGTTCGT
GTGCTGACCGACCAGCCCCCCGCCGAGGACACCCTGAGGACCGTGATCAGCACCGAGAAC
ACCGGCGGATGGGAGCTCAACATCGACTACGCCGGCGAGGCGCCGGGCATGCACTTCGCG
TTCTGGAAGGGGCCCGAGATCAGCGACTACCACAGCGCTCTATGTTTCTGCCTGGAGCTC
CAGCGGTGGACACACGCCGCCGGGGTCGTCGACGGCGAGGCGCTCACCATGAGCCTCTAC
ATCGACGGGCGCCTCTACAGCACCATGCCCATCGAGAAGACGATCTCGCCCGGCCCGACC
AGCCTCTACGTCGGTCGATGGCCGCAGGAGGGTCGGCTCCTCGTCGGGGACGTCGACGAC
ATCGCGATCTACAGCCGAGCGCTCGCCGCGGCGGAGGTCGCCGAGCTCTCCCAGCACGCC
GTCCCGGCGGAGGTCGAGGCGGACATCTCGACGGACACCACCTACACCCTGGTCGGCGTC
CAGAGCGGGCTCTGCGTGGACGTCGACGCCGCCGTGATCACGGCCGACGATGTCGTCCTG
CAGCTCTGGGATTGCAACGGCGGCACCAACCAGCAGTTCCGCTTCGAGGCGGTGGACGGC
GGGTATTACCGGATCCGCAACGTCCAGAGCGACAAGTGCCTCGACGTCCGCAGCGCGTCG
ACCGCCGACGGCGCCGCCATCGTCCAGTACACCTGCCACGACAACGCCAACCAGCAATGG
TCCGTCACCGAGGCAGGCGACGGCGCCGTCCGCATCACGTCGCGCCTCAGCGGCAGGGTC
ATCGACGCTTACGGCTCCCCGCCCGCCAGCGGCACCGCCCTCGTCCAGAGGGCTTCCAGC
GGCGGCACCAGCCAGCAGTTCAAGCTGACCCCGCTCGAAACTGGCACCGGCACCGGCGGC
ACCGGCGGCACCGGCGGCACCGGCGGCACCGGCGGCACGGGCCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000772 Ricin B lectin domain (Domain)
 [172-312]  5.09998762524166e-37 SSF50370
SSF50370   RicinB_like
 [173-307]  2.1e-22 PF00652
PF00652   Ricin_B_lectin
 [172-310]  1.99999636034521e-23 SM00458
SM00458   RICIN
 [171-310]  PS50231
PS50231   RICIN_B_LECTIN
IPR008985 Concanavalin A-like lectin/glucanase (Domain)
 [9-167]  7.49999605851445e-23 SSF49899
SSF49899   ConA_like_lec_gl
IPR013320 Concanavalin A-like lectin/glucanase, subgroup (Domain)
 [6-160]  5.40000000000002e-21 G3DSA:2.60.120.200
G3DSA:2.60.120.200   ConA_like_subgrp
SignalP No significant hit
TMHMM No significant hit
Soraph_00120 Soraph_00120   last last