close all open/close all
first first   Spino_00020 Spino_00020

CDS information : Spino_00010


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction1,971 / 1,135 / - [in whole cluster]
1,971 / 1,135 / - [in contig]
Locationcomplement(1135..1971) [in whole cluster]
complement(1135..1971) [in contig]
TypeCDS
Length837 bp (278 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative LysR family transcriptional regulator
Product (GenBank)probable lysR-type transcriptional regulator
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in spinosyn biosynthesis.
Note (GenBank)
  • ORF L16
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
Family/Domain
FD
IPR000847, IPR005119

close this sectionSequence

selected fasta
>putative LysR family transcriptional regulator [probable lysR-type transcriptional regulator]
METRELRYFVAVAEELHFGRAAQRLGIAQPPLSRTIAQLEQRLGVVLLQRTSRKVSLTEA
GAMLLTEGRAILGALAAAERRTQRAATSQPSLVLAAKAGASGELLAKLLDAYAAEPGAVA
VDLLLCESQPQKTLHDGRADVALLHQPFDPTAELDIEILNTEQQVAILPTSHPLASEPHV
RMADVSSLPDLPLARWPGPDGVYPDGPGVEVRNQTQLFQMIALGRTTVVMPESSRVNLLE
GLAAVPVLDAPDVTTVIAWPPHSRSRALAGLVRVATLL
selected fasta
>putative LysR family transcriptional regulator [probable lysR-type transcriptional regulator]
ATGGAGACGCGGGAGTTGCGGTACTTCGTTGCAGTCGCCGAGGAGTTGCACTTCGGCCGG
GCCGCCCAGCGCCTGGGCATCGCCCAGCCGCCGCTGTCGCGGACGATCGCCCAGCTCGAG
CAACGACTCGGAGTCGTGTTGCTGCAACGCACCAGCCGCAAAGTCTCGCTCACCGAAGCC
GGGGCAATGCTGCTGACCGAAGGCCGGGCGATCCTCGGCGCGCTGGCAGCAGCCGAGCGA
CGCACCCAGCGTGCCGCGACGAGCCAGCCCTCGCTAGTCCTGGCTGCCAAGGCCGGCGCC
TCCGGTGAGCTGCTGGCGAAGTTGCTCGACGCGTACGCCGCCGAGCCGGGAGCCGTGGCC
GTCGACCTGCTGCTCTGCGAATCCCAGCCCCAGAAAACGCTGCATGACGGCCGGGCCGAC
GTGGCGCTGTTGCATCAACCCTTCGACCCGACGGCCGAACTCGACATCGAAATTCTGAAC
ACCGAGCAACAAGTCGCCATTCTTCCGACCTCGCATCCGCTTGCCAGCGAGCCCCATGTA
CGGATGGCGGATGTCAGCTCACTGCCGGATCTCCCGCTTGCGCGCTGGCCCGGCCCCGAC
GGCGTCTATCCAGATGGCCCCGGCGTGGAAGTACGCAACCAGACGCAACTGTTCCAAATG
ATCGCACTCGGCCGCACTACCGTGGTCATGCCCGAATCCAGTCGCGTCAACCTGCTCGAA
GGCCTCGCCGCCGTACCGGTTCTAGACGCGCCGGACGTGACGACAGTCATCGCCTGGCCG
CCCCACAGCCGCTCCCGAGCACTCGCCGGCTTGGTCCGCGTGGCCACACTCCTCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000847 Transcription regulator HTH, LysR (Domain)
 [4-61]  1.8e-22 PF00126
PF00126   HTH_1
 [1-58]  PS50931
PS50931   HTH_LYSR
 [18-29]  3.0999994589937e-08 PR00039 [29-39]  3.0999994589937e-08 PR00039 [39-50]  3.0999994589937e-08 PR00039
PR00039   HTHLYSR
IPR005119 LysR, substrate-binding (Domain)
 [89-273]  3.2e-12 PF03466
PF03466   LysR_substrate
IPR011991 Winged helix-turn-helix transcription repressor DNA-binding (Domain)
 [1-81]  1.8e-26 G3DSA:1.10.10.10
G3DSA:1.10.10.10   Wing_hlx_DNA_bd
SignalP
 [1-28]  0.087 Signal
Eukaryota   
TMHMM No significant hit
first first   Spino_00020 Spino_00020