close all open/close all

CDS information : Spino_00020


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction2,024 / 2,791 / + [in whole cluster]
2,024 / 2,791 / + [in contig]
Location2024..2791 [in whole cluster]
2024..2791 [in contig]
TypeCDS
Length768 bp (255 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative oxidoreductase
Product (GenBank)probable keto acyl reductase
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF L15
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
Family/Domain
FD
IPR002198

close this sectionSequence

selected fasta
>putative oxidoreductase [probable keto acyl reductase]
MVLVPRRFRATLESMSEQTIALVTGANKGIGYEIAAGLGALGWSVGIGARDHQRGEDAVA
KLRADGVDAFAVSLDVTDDASVAAAAALLEERAGRLDVLVNNAGIAGAWPEEPSTVTPAS
LRAVVETNVIGVVRVTNAMLPLLRRSERPRIVNQSSHVASLTLQTTPGVDLGGISGAYSP
SKTFLNAITIQYAKELSDTNIKINNACPGYVATDLNGFHGTSTPADGARIAIRLATLPDD
GPTGGMFDDAGNVPW
selected fasta
>putative oxidoreductase [probable keto acyl reductase]
ATGGTGTTGGTTCCCCGCCGGTTTCGGGCCACGCTAGAAAGCATGAGCGAACAGACGATT
GCACTGGTCACCGGCGCAAACAAGGGAATCGGATACGAGATCGCGGCCGGGCTCGGCGCG
CTGGGGTGGAGCGTCGGAATCGGGGCACGGGACCACCAGCGCGGGGAGGATGCCGTGGCG
AAATTGCGTGCGGACGGCGTCGATGCGTTCGCGGTATCCCTGGACGTGACAGACGACGCG
AGCGTCGCGGCTGCTGCGGCTCTGCTCGAGGAGCGCGCCGGCCGGCTCGATGTGCTGGTT
AATAACGCCGGCATCGCCGGGGCATGGCCGGAGGAGCCCTCGACCGTCACACCGGCGAGC
CTCCGGGCGGTGGTGGAGACCAACGTGATCGGCGTCGTTCGGGTTACCAACGCTATGCTG
CCGTTGCTACGCCGCTCCGAGCGCCCGCGGATCGTCAACCAGTCCAGCCACGTCGCTTCC
CTGACCTTGCAAACCACGCCGGGCGTCGACCTCGGCGGGATCAGCGGAGCCTACTCACCG
TCGAAGACGTTCCTCAACGCGATCACCATCCAGTACGCCAAGGAACTCAGCGATACCAAC
ATCAAAATCAACAACGCCTGCCCCGGCTACGTCGCGACCGACCTTAACGGCTTCCACGGA
ACCAGCACGCCGGCAGACGGTGCCAGGATCGCCATTCGGCTCGCCACGCTGCCAGACGAC
GGCCCGACCGGAGGCATGTTCGACGACGCCGGGAATGTGCCCTGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [20-195]  1.8e-22 PF00106
PF00106   adh_short
 [94-105]  1.6999992228405e-05 PR00080 [178-197]  1.6999992228405e-05 PR00080
PR00080   SDRFAMILY
IPR002347 Glucose/ribitol dehydrogenase (Family)
 [20-37]  1.79999754022375e-23 PR00081 [94-105]  1.79999754022375e-23 PR00081 [143-159]  1.79999754022375e-23 PR00081 [178-197]  1.79999754022375e-23 PR00081 [199-216]  1.79999754022375e-23 PR00081
PR00081   GDHRDH
IPR016040 NAD(P)-binding domain (Domain)
 [19-248]  5.00000000000001e-58 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP No significant hit
TMHMM No significant hit