close all open/close all

CDS information : Spino_00030


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction4,165 / 3,416 / - [in whole cluster]
4,165 / 3,416 / - [in contig]
Locationcomplement(3416..4165) [in whole cluster]
complement(3416..4165) [in contig]
TypeCDS
Length750 bp (249 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose N,N-dimethyltransferase
Product (GenBank)probable N-dimethyltransferase
Gene
Gene (GenBank)spnS
EC number2.1.1.-
Keyword
  • D-forosamine
Note
Note (GenBank)
  • probably involved in forosamine biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>NDP-hexose N,N-dimethyltransferase [probable N-dimethyltransferase]
MSRVSDTFAETSSVYSPDHADIYDAIHSARGRDWAAEAGEVVQLVRTRLPEAQSLLDVAC
GTGAHLERFRAEYAKVAGLELSDAMREIAIRRVPEVPIHIGDIRDFDLGEPFDVITCLCF
TAAYMRTVDDLRRVTRNMARHLAPGGVAVIEPWWFPDKFIDGFVTGAVAHHGERVISRLS
HSVLEGRTSRMTVRYTVAEPTGIRDFTEFEILSLFTEDEYTAALEDAGIRAEYLPGAPNG
RGLFVGIRN
selected fasta
>NDP-hexose N,N-dimethyltransferase [probable N-dimethyltransferase]
ATGTCGCGCGTGAGCGACACATTCGCAGAAACCTCCTCGGTATACAGCCCAGATCATGCC
GACATCTACGACGCGATCCACTCCGCGCGTGGCCGGGACTGGGCAGCCGAGGCCGGGGAA
GTAGTCCAGCTCGTACGCACCAGGCTGCCCGAAGCACAGTCCCTACTCGACGTCGCCTGT
GGGACCGGGGCGCACCTAGAGCGATTCCGTGCCGAATACGCGAAGGTCGCGGGGCTTGAA
CTGTCCGATGCGATGCGGGAGATCGCGATCAGACGAGTCCCTGAGGTACCGATTCACATC
GGTGACATCCGCGATTTCGACCTCGGCGAGCCATTCGACGTCATCACCTGCCTGTGCTTT
ACCGCGGCTTACATGCGGACCGTTGACGACCTGCGACGCGTGACGCGGAACATGGCCCGG
CACCTGGCCCCTGGTGGAGTCGCGGTCATCGAACCCTGGTGGTTTCCCGACAAGTTCATC
GACGGGTTCGTCACCGGAGCCGTCGCGCACCACGGCGAGCGGGTGATCAGCCGGCTATCG
CACTCGGTCCTGGAGGGCCGTACGAGCCGGATGACCGTCCGCTACACAGTCGCCGAACCC
ACCGGGATCCGGGACTTCACAGAGTTCGAAATCCTCTCGCTGTTCACTGAGGACGAGTAC
ACCGCCGCGCTCGAAGACGCAGGGATCCGCGCGGAATACCTTCCTGGAGCACCGAACGGC
CGAGGCCTGTTCGTCGGAATCCGCAACTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP
 [1-35]  0.047 Signal
Bacteria, Gram-negative   
TMHMM No significant hit