close all open/close all

CDS information : Spino_00040


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction5,325 / 4,168 / - [in whole cluster]
5,325 / 4,168 / - [in contig]
Locationcomplement(4168..5325) [in whole cluster]
complement(4168..5325) [in contig]
TypeCDS
Length1,158 bp (385 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductNDP-hexose C-4 aminotransferase
Product (GenBank)probable aminotransferase
Gene
Gene (GenBank)spnR
EC number2.6.1.-
Keyword
  • D-forosamine
Note
Note (GenBank)
  • probably involved in forosamine biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[15913355] Characterization of protein encoded by spnR from the spinosyn gene cluster of Saccharopolyspora spinosa: mechanistic implications for forosamine biosynthesis. (J Am Chem Soc. , 2005)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>NDP-hexose C-4 aminotransferase [probable aminotransferase]
MINLHQPILGTEELDAIAEVFASNWIGLGPRTRTFEAEFAHHLGVDPEQVVFLNSGTAAL
FLTVQVLDLGPGDDVVLPSISFVAAANAIASSGARPVFCDVDPRTLNPTLDDVARAITPA
TKAVLLLHYGGSPGEVTAIADFCREKGLMLIEDSACAVASSVHGTACGTFGDLATWSFDA
MKILVTGDGGMFYAADPELAHRARRLAYHGLEQMSGFDSAKSSNRWWDIRVEDIGQRLIG
NDMTAALGSVQLRKLPEFINRRREIATQYDRLLSDVPGVLLPPTLPDGHVSSHYFYWVQL
APEIRDQVAQQMLERGIYTSYRYPPLHKVPIYRADCKLPSAEDACRRTLLLPLHPSLDDA
EVRTVADEFQKAVEHHISQRSPLRK
selected fasta
>NDP-hexose C-4 aminotransferase [probable aminotransferase]
GTGATCAACCTGCACCAGCCGATCCTCGGCACCGAAGAACTCGACGCGATCGCGGAGGTG
TTCGCCTCCAACTGGATCGGGCTCGGGCCGCGCACCCGGACGTTCGAGGCCGAATTCGCC
CACCACCTGGGAGTGGATCCCGAACAGGTCGTGTTCCTCAACTCGGGGACTGCCGCGCTG
TTCCTTACCGTGCAGGTGCTCGACCTCGGCCCAGGCGACGACGTGGTACTTCCTTCGATA
AGCTTCGTGGCGGCGGCCAACGCCATCGCATCCTCCGGTGCCCGCCCGGTGTTCTGCGAC
GTCGACCCCCGGACGTTGAACCCCACGCTGGATGATGTGGCGAGGGCCATCACGCCGGCG
ACCAAGGCCGTATTGCTGCTCCACTATGGAGGATCGCCGGGAGAAGTCACCGCGATCGCC
GATTTCTGCCGTGAAAAGGGCCTCATGCTCATCGAGGACTCCGCCTGCGCGGTGGCATCG
TCCGTGCACGGCACCGCTTGCGGAACCTTTGGTGACCTGGCCACGTGGAGTTTCGATGCG
ATGAAGATCCTGGTCACCGGGGATGGGGGCATGTTCTACGCGGCGGATCCGGAGCTGGCG
CACCGCGCAAGACGACTCGCCTACCACGGTCTTGAGCAGATGAGCGGATTCGATTCGGCC
AAGTCTTCCAACCGCTGGTGGGATATTCGCGTCGAAGACATCGGCCAGCGGCTGATCGGG
AACGACATGACGGCAGCGCTTGGCAGCGTGCAGCTGCGCAAACTGCCAGAATTCATCAAC
AGGCGTAGAGAAATCGCTACGCAGTACGACCGGTTGCTTTCCGATGTGCCGGGTGTCCTC
CTACCGCCGACGCTACCGGATGGGCACGTCTCGTCACACTACTTCTACTGGGTCCAGCTG
GCTCCGGAGATCCGCGACCAGGTGGCGCAGCAAATGCTGGAACGCGGCATCTACACGAGC
TACCGCTACCCGCCCCTGCACAAGGTCCCCATCTACCGCGCGGACTGCAAGCTGCCTTCT
GCGGAGGACGCCTGCCGCAGAACACTCCTGCTACCACTGCACCCAAGCCTTGACGACGCC
GAGGTGCGCACGGTGGCTGACGAGTTCCAGAAGGCCGTCGAACACCACATCAGCCAAAGA
TCACCACTCCGAAAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000653 DegT/DnrJ/EryC1/StrS aminotransferase (Family)
 [1-377]  2.0000139277205e-83 PIRSF000390
PIRSF000390   PLP_StrS
 [9-370]  1.10000000000001e-94 PF01041
PF01041   DegT_DnrJ_EryC1
IPR015421 Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (Domain)
 [2-253]  9.49999999999983e-67 G3DSA:3.40.640.10
G3DSA:3.40.640.10   PyrdxlP-dep_Trfase_major_sub1
IPR015422 Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (Domain)
 [255-375]  1.4e-30 G3DSA:3.90.1150.10
G3DSA:3.90.1150.10   PyrdxlP-dep_Trfase_major_sub2
IPR015424 Pyridoxal phosphate-dependent transferase, major domain (Domain)
 [1-376]  1.69998802370953e-90 SSF53383
SSF53383   PyrdxlP-dep_Trfase_major
SignalP
 [1-34]  0.056 Signal
Eukaryota   
TMHMM No significant hit