close all open/close all

CDS information : Spino_00060


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction7,083 / 8,450 / + [in whole cluster]
7,083 / 8,450 / + [in contig]
Location7083..8450 [in whole cluster]
7083..8450 [in contig]
TypeCDS
Length1,368 bp (455 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)probable NDP-forosamyltransferase
Gene
Gene (GenBank)spnP
EC number
Keyword
  • D-forosamine
Note
Note (GenBank)
  • involved in forosamine addition
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[12120151] Engineered biosynthesis of novel spinosyns bearing altered deoxyhexose substituents. (Chem Commun (Camb). , 2002)
[19343260] Glycosylation engineering of spinosyn analogues containing an L-olivose moiety. (Org Biomol Chem. , 2009)
[24945604] Structural studies of the spinosyn forosaminyltransferase, SpnP. (Biochemistry. , 2014)

close this sectionSequence

selected fasta
>glycosyltransferase [probable NDP-forosamyltransferase]
MILGMLPGCSIAIGEFMRVLFTPLPASSHFFNLVPLAWALRAAGHEVRVAICPNMVSMVT
GAGLTAVPVGDELDLISLAAKNELVLGSGVSFDEKGRHPELFDELLSINSGRDTDAVEQL
HLVDDRSLDDLMGFAEKWQPDLVVWDAMVCSGPVVARALGARHVRMLVALDVSGWLRSGF
LEYQESKPPEQRVDPLGTWLGAKLAKFGATFDEEIVTGQATIDPIPSWMRLPVDLDYISM
RFVPYNGPAVLPEWLRERPTKPRVCITRGLTKRRLSRVTEQYGEQSDQEQAMVERLLRGA
ARLDVEVIATLSDDEVREMGELPSNVRVHEYVPLNELLESCSVIIHHGSTTTQETATVNG
VPQLILPGTFWDESRRAELLADRGAGLVLDPATFTEDDVRGQLARLLDEPSFAANAALIR
REIEESPSPHDIVPRLEKLVAERENRRTGQSDGHP
selected fasta
>glycosyltransferase [probable NDP-forosamyltransferase]
GTGATTCTTGGCATGCTTCCCGGGTGTTCAATTGCGATCGGAGAGTTCATGCGTGTCCTG
TTCACCCCGCTGCCGGCGAGTTCGCACTTCTTCAACCTGGTGCCGTTGGCGTGGGCGTTG
CGTGCCGCGGGGCACGAGGTCCGTGTCGCCATCTGCCCGAATATGGTGTCGATGGTCACC
GGAGCAGGACTCACCGCGGTTCCCGTCGGCGACGAGCTCGACCTCATCTCCTTGGCGGCC
AAGAACGAACTCGTTCTCGGCAGCGGGGTCTCGTTCGACGAGAAGGGGCGGCATCCGGAA
CTCTTCGACGAGCTGCTGTCAATCAACTCCGGCAGAGACACGGACGCCGTGGAGCAACTC
CACCTTGTGGATGACCGATCGCTGGACGATCTCATGGGGTTCGCCGAGAAATGGCAGCCT
GATCTCGTTGTGTGGGACGCTATGGTGTGTTCGGGGCCAGTTGTGGCGCGAGCGCTCGGC
GCACGACACGTGCGGATGCTCGTCGCCCTCGATGTGTCGGGGTGGCTGCGGTCCGGTTTC
CTCGAATACCAGGAATCGAAGCCGCCTGAGCAGCGCGTCGACCCGCTCGGGACGTGGCTG
GGAGCGAAGCTCGCCAAGTTCGGAGCCACGTTCGATGAAGAGATCGTGACGGGCCAAGCG
ACCATAGATCCGATTCCATCCTGGATGCGCCTGCCTGTGGACTTGGACTACATCTCGATG
CGTTTCGTGCCGTACAACGGTCCGGCGGTGTTGCCGGAGTGGTTGCGCGAACGACCGACG
AAGCCGCGCGTCTGCATCACGCGCGGGCTGACCAAGCGGCGGCTGAGCAGGGTGACCGAA
CAGTACGGGGAGCAAAGTGACCAGGAACAAGCAATGGTGGAAAGGTTGTTGCGCGGCGCG
GCCAGGCTCGACGTCGAGGTGATCGCCACCTTGTCTGACGACGAAGTACGGGAGATGGGG
GAGTTGCCCTCGAACGTCCGGGTCCACGAATACGTACCGCTCAACGAACTGCTGGAGTCG
TGTTCAGTGATCATCCATCATGGCTCGACGACGACGCAGGAAACCGCCACGGTCAACGGC
GTACCGCAGTTGATTCTCCCTGGGACCTTCTGGGACGAATCTCGTAGGGCGGAGCTCCTA
GCCGATCGGGGAGCCGGTCTGGTCCTCGACCCCGCGACGTTTACCGAAGACGACGTGCGA
GGTCAGCTGGCCCGCCTGCTCGACGAGCCGTCGTTCGCTGCCAACGCGGCGCTGATCCGC
CGTGAAATCGAGGAAAGTCCCAGCCCGCACGACATCGTTCCACGTCTGGAAAAGCTAGTT
GCCGAACGTGAGAACCGCCGCACTGGGCAGTCTGATGGCCATCCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [19-145]  1.1e-16 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [222-327]  2.80000000000001e-26 PF06722
PF06722   DUF1205
SignalP
 [1-39]  0.388 Signal
Bacteria, Gram-positive   
TMHMM No significant hit