close all open/close all

CDS information : Spino_00070


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction8,967 / 10,427 / + [in whole cluster]
8,967 / 10,427 / + [in contig]
Location8967..10427 [in whole cluster]
8967..10427 [in contig]
TypeCDS
Length1,461 bp (486 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase
Product (GenBank)probable NDP-hexose-2,3-dehydratase
Gene
Gene (GenBank)spnO
EC number
Keyword
  • D-forosamine
Note
Note (GenBank)
  • involved in forosamine biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [probable NDP-hexose-2,3-dehydratase]
MSSSVEAEASAAAPLGSNNTRRFVDSALSACNGMIPTTEFHCWLADRLGENSFETNRIPF
DRLSKWKFDASTENLVHADGRFFTVEGLQVETNYGAAPSWHQPIINQAEVGILGILVKEI
DGVLHCLMSAKMEPGNVNVLQLSPTVQATRSNYTQAHRGSVPPYVDYFLGRGRGRVLVDV
LQSEQGSWFYRKRNRNMVVEVQEEVPVLPDFCWLTLGQVLALLRQDNIVNMDTRTVLSCI
PFHDSATGPELAASEEPFRQAVARSLSHGIDSSSISEAVGWFEEAKARYRLRATRVPLSR
VDKWYRTDTEIAHQDGKYFAVIAVSVSATNREVASWTQPMIEPREQGEIALLVKRIGGVL
HGLVHARVEAGYKWTAEIAPTVQCSVANYQSTPSNDWPPFLDDVLTADPETVRYESILSE
EGGRFYQAQNRYRIIEVHEDFAARPPSDFRWMTLGQLGELLRSTHFLNIQARSLVASLHS
LWALGR
selected fasta
>dTDP-4-keto-6-deoxy-D-glucose 2,3-dehydratase [probable NDP-hexose-2,3-dehydratase]
ATGAGCAGTTCTGTCGAAGCTGAGGCAAGTGCTGCTGCGCCGCTCGGCAGCAACAACACG
CGGCGGTTCGTCGACTCTGCGCTGAGCGCTTGCAATGGCATGATTCCGACCACGGAGTTC
CACTGCTGGCTCGCCGATCGGCTGGGCGAGAACAGCTTCGAGACCAATCGCATCCCGTTC
GACCGCCTGTCGAAATGGAAATTCGATGCCAGCACGGAGAACCTGGTTCATGCCGACGGT
AGGTTCTTCACGGTAGAAGGCCTGCAGGTCGAGACCAACTATGGCGCGGCACCCAGCTGG
CACCAGCCGATCATCAACCAGGCTGAAGTAGGTATCCTCGGCATTCTCGTCAAGGAGATC
GACGGCGTGCTGCACTGCCTCATGTCAGCAAAGATGGAACCGGGCAACGTCAACGTCCTG
CAGCTCTCGCCGACGGTTCAGGCAACTCGGAGCAACTACACGCAGGCACACCGTGGCAGC
GTTCCGCCCTATGTGGACTACTTCCTCGGGCGGGGCCGCGGCCGCGTGCTGGTAGACGTG
CTCCAGTCTGAACAGGGGTCCTGGTTCTACCGGAAGCGCAACCGGAACATGGTGGTGGAA
GTCCAGGAGGAAGTGCCAGTCCTGCCAGACTTCTGCTGGTTGACGCTCGGCCAGGTGCTG
GCTCTCCTTCGTCAGGACAACATCGTCAACATGGACACCCGGACGGTGCTGTCTTGCATC
CCGTTCCACGATTCCGCCACCGGACCCGAACTAGCCGCCTCGGAGGAGCCCTTCCGACAG
GCGGTGGCCAGGTCGCTCTCGCACGGCATCGATTCGTCGAGTATCTCCGAGGCGGTCGGT
TGGTTCGAGGAAGCCAAGGCCCGCTACCGCTTGCGGGCAACGCGCGTTCCGCTGAGCAGG
GTCGACAAGTGGTATCGCACCGATACCGAGATCGCCCACCAGGACGGCAAGTACTTCGCG
GTGATCGCGGTGTCGGTGTCCGCGACCAATCGTGAGGTCGCCAGCTGGACGCAGCCGATG
ATCGAACCGCGAGAACAAGGTGAGATCGCACTGTTGGTCAAGCGGATCGGCGGAGTGCTG
CACGGTTTGGTCCACGCTCGGGTGGAGGCTGGGTATAAGTGGACTGCGGAAATCGCTCCC
ACGGTCCAGTGCAGTGTGGCCAACTACCAAAGCACCCCGTCGAACGACTGGCCGCCGTTC
TTGGACGACGTGCTCACCGCCGATCCCGAAACCGTGCGGTACGAATCGATCCTGTCCGAA
GAAGGCGGTCGGTTCTACCAGGCGCAGAACAGGTACCGGATCATCGAGGTGCATGAGGAC
TTCGCGGCACGACCTCCCAGCGACTTCCGGTGGATGACTTTGGGACAGTTGGGCGAGCTG
CTCCGGAGCACCCACTTCTTGAACATCCAGGCGCGCAGCTTGGTCGCCTCCCTGCATAGC
TTGTGGGCGTTGGGGCGATGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005212 NDP-hexose 2,3-dehydratase (Domain)
 [37-240]  1.29999999999998e-87 PF03559 [275-478]  9.39999999999981e-80 PF03559
PF03559   Hexose_dehydrat
SignalP
 [1-30]  0.325 Signal
Bacteria, Gram-positive   
TMHMM No significant hit