close all open/close all

CDS information : Spino_00080


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction10,436 / 11,434 / + [in whole cluster]
10,436 / 11,434 / + [in contig]
Location10436..11434 [in whole cluster]
10436..11434 [in contig]
TypeCDS
Length999 bp (332 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductdTDP-hexose C-3 ketoreductase
Product (GenBank)probable NDP-hexose-3-ketoreductase
Gene
Gene (GenBank)spnN
EC number
Keyword
  • D-forosamine
Note
Note (GenBank)
  • involved in forosamine biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[18345667] In vitro characterization of the enzymes involved in TDP-D-forosamine biosynthesis in the spinosyn pathway of Saccharopolyspora spinosa. (J Am Chem Soc. , 2008)

close this sectionSequence

selected fasta
>dTDP-hexose C-3 ketoreductase [probable NDP-hexose-3-ketoreductase]
MRKPVRIGVLGCASFAWRRMLPAMCDVAETEVVAVASRDPAKAERFAARFECEAVLGYQR
LLERPDIDAVYVPLPPGMHAEWIGKALEADKHVLAEKPLTTTASDTARLVGLARRKNLLL
RENYLFLHHGRHDVVRDLLQSGEIGELREFTAVFGIPPLPDTDIRYRTELGGGALLDIGV
YPARAARHFLLGPLTVLGASSHEAQESGVDLSGSVLLQSEGGTVAHLGYGFVHHYRSAYE
LWGSRGRIVVDRAFTPPAEWQAVIRIERKGVVDELSLPAEDQVRKAVTAFARDIRAGTGV
DDPAVAGDSGESMIQQAALVEAIGQARRCGST
selected fasta
>dTDP-hexose C-3 ketoreductase [probable NDP-hexose-3-ketoreductase]
ATGCGAAAGCCGGTGCGCATCGGTGTGCTCGGGTGCGCTTCCTTCGCGTGGCGACGGATG
CTGCCCGCGATGTGCGACGTGGCCGAAACAGAGGTGGTGGCGGTGGCGAGCCGTGATCCG
GCGAAAGCCGAACGGTTCGCAGCGCGATTCGAATGCGAGGCGGTGCTGGGTTACCAGCGG
CTCCTGGAGCGGCCGGACATCGATGCCGTCTACGTGCCGTTGCCGCCTGGCATGCATGCA
GAGTGGATCGGCAAGGCGCTTGAGGCAGACAAACACGTGCTTGCGGAGAAACCGCTGACG
ACGACGGCGTCCGACACCGCTCGCCTGGTCGGGCTGGCCAGGAGGAAGAACCTGCTGCTG
CGGGAGAATTACCTGTTCCTCCACCACGGCCGGCACGACGTGGTCCGCGACCTGCTGCAA
TCCGGGGAGATCGGTGAGCTCCGGGAGTTCACCGCCGTGTTCGGAATTCCGCCGCTTCCC
GACACGGACATCCGCTATCGCACCGAACTCGGTGGCGGAGCGTTGCTGGACATCGGTGTC
TATCCCGCCCGTGCCGCTCGGCACTTTCTCCTCGGTCCGCTCACGGTTCTCGGCGCAAGC
TCGCACGAGGCCCAGGAGTCGGGCGTCGACTTGTCGGGCAGCGTGCTGCTCCAATCGGAA
GGTGGCACCGTTGCCCACCTCGGATACGGTTTCGTGCACCACTACCGCAGCGCGTACGAG
CTGTGGGGGAGTCGTGGGCGAATCGTCGTCGACCGGGCGTTCACGCCGCCCGCCGAGTGG
CAGGCCGTGATCCGAATCGAGCGGAAGGGCGTTGTCGACGAGTTGTCCTTGCCAGCGGAA
GATCAGGTTCGCAAGGCGGTCACCGCCTTCGCACGCGACATCAGAGCAGGGACAGGCGTG
GACGACCCTGCGGTGGCCGGAGATTCGGGCGAATCGATGATCCAGCAGGCCGCGCTGGTG
GAGGCGATCGGTCAGGCCCGTCGGTGCGGGTCCACATAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000683 Oxidoreductase, N-terminal (Domain)
 [5-123]  4.10000000000001e-27 PF01408
PF01408   GFO_IDH_MocA
IPR004104 Oxidoreductase, C-terminal (Domain)
 [136-239]  2.3e-05 PF02894
PF02894   GFO_IDH_MocA_C
IPR016040 NAD(P)-binding domain (Domain)
 [1-145]  2.50000000000001e-41 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
SignalP
 [1-22]  0.887 Signal
Eukaryota   
 [1-23]  0.406 Signal
Bacteria, Gram-positive   
TMHMM No significant hit