close all open/close all

CDS information : Spino_00090


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction12,696 / 11,530 / - [in whole cluster]
12,696 / 11,530 / - [in contig]
Locationcomplement(11530..12696) [in whole cluster]
complement(11530..12696) [in contig]
TypeCDS
Length1,167 bp (388 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
ProductC-11,14 dehydratase
Product (GenBank)SpnM
Gene
Gene (GenBank)spnM
EC number
Keyword
Note
  • The N-terminal position was modified from original INSDC entry.
Note (GenBank)
  • involved in spinosyn aglycone biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[21544146] Enzyme-catalysed [4+2] cycloaddition is a key step in the biosynthesis of spinosyn A. (Nature. , 2011)

close this sectionSequence

selected fasta
>C-11,14 dehydratase [SpnM]
MASEHASLVGDDLRAPADDPFYRPPTPLPPGVPGTLLRARPVSALRGTGEPVAAKAWQIL
YRSNSALGMPNAVSGTVLVPNIPWPREDRPIITFAVGTHGLGSQVAPSYLLRTGTEPETE
LIAVALDRGWAVVITDYEGLGTPGTHTYTVGRAQGHAMLDAARAAQRLPGSGLTTDCPVG
IWGYAQGGQASAFAGELHPTYAPELRIRAAAAGAVPIDLLDIIHRNDGVFTGPVLAGLVG
HAAAYPDLPFDELLTEAGRTAVDQVRELGAPELVTRFLGRELSDFLDTSGLFEQPRWRAR
LAESVAGRNGGPVVPTLVYHSTDDEIVPFAFGERLRDSYRAAGTPVRWHPLSGLAHFPAA
LASSRVVVSWFDEHFSEPSAISGPRDAR
selected fasta
>C-11,14 dehydratase [SpnM]
ATGGCCTCCGAGCACGCCAGCCTGGTCGGCGACGATCTGCGGGCACCCGCGGATGATCCC
TTCTACCGACCGCCGACGCCGCTACCGCCGGGTGTCCCGGGCACGCTCCTCAGGGCCCGG
CCCGTCTCGGCACTGCGCGGCACGGGCGAACCCGTCGCAGCCAAGGCCTGGCAAATCCTC
TACCGGTCCAACTCCGCCCTTGGCATGCCGAACGCCGTCTCCGGCACCGTTCTGGTGCCG
AACATCCCGTGGCCGCGCGAAGATCGCCCCATCATCACTTTCGCAGTGGGCACCCACGGC
CTCGGTAGCCAAGTTGCCCCGTCGTACCTGCTTCGAACCGGAACCGAGCCGGAGACCGAG
CTGATCGCCGTGGCCCTCGACCGCGGGTGGGCCGTGGTCATCACCGACTACGAAGGCCTC
GGTACTCCTGGAACCCACACCTACACCGTCGGCAGGGCGCAGGGACACGCCATGCTCGAT
GCCGCCCGCGCTGCGCAACGGCTACCGGGCTCCGGCCTGACGACCGACTGCCCGGTCGGC
ATCTGGGGCTATGCGCAGGGTGGGCAAGCGTCGGCCTTCGCCGGCGAACTGCACCCCACC
TACGCACCTGAACTGCGAATCCGCGCTGCGGCCGCAGGTGCGGTGCCGATCGATCTGCTG
GACATCATCCACCGAAATGACGGGGTGTTCACCGGGCCGGTGCTGGCCGGCCTGGTCGGG
CATGCCGCTGCCTACCCCGATCTGCCATTCGACGAGCTTCTCACCGAAGCGGGTCGTACC
GCCGTTGATCAAGTGCGCGAGCTCGGTGCACCGGAGCTCGTCACCCGCTTCCTCGGCCGC
GAGCTGAGCGACTTCCTCGACACTTCCGGCCTTTTCGAGCAACCTCGATGGCGCGCACGA
CTGGCCGAAAGCGTCGCAGGTAGGAACGGTGGCCCGGTGGTCCCCACGCTCGTCTACCAC
AGCACGGACGACGAGATCGTTCCGTTCGCATTCGGCGAGCGACTCCGGGACAGCTACCGC
GCGGCGGGTACGCCAGTGCGGTGGCATCCGCTCTCCGGATTGGCTCACTTTCCCGCCGCC
CTGGCCAGCTCGCGAGTGGTCGTCTCGTGGTTCGACGAGCACTTCTCCGAGCCGTCCGCG
ATCAGCGGTCCGCGAGATGCCAGGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR005152 Lipase, secreted (Family)
 [113-383]  1.7e-86 PF03583
PF03583   LIP
SignalP No significant hit
TMHMM No significant hit