close all open/close all

CDS information : Spino_00100


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction13,547 / 12,696 / - [in whole cluster]
13,547 / 12,696 / - [in contig]
Locationcomplement(12696..13547) [in whole cluster]
complement(12696..13547) [in contig]
TypeCDS
Length852 bp (283 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)methyltransferase-like protein
Gene
Gene (GenBank)spnL
EC number
Keyword
  • C-3 and C-14
Note
Note (GenBank)
  • involved in spinosyn aglycone biosynthesis; possibly involved in polyketide bridging
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[21544146] Enzyme-catalysed [4+2] cycloaddition is a key step in the biosynthesis of spinosyn A. (Nature. , 2011)

close this sectionSequence

selected fasta
>cyclase [methyltransferase-like protein]
MESIFDALAHGRPLHHGYWAGGYREDAGATPWSDAADQLTDLFIDKAALRPGAHLFDLGC
GNGQPVVRAACASGVRVTGITVNAQHLAAATRLANETGLAGSLEFDLVDGAQLPYPDGFF
QAAWAMQSVVQIVDQAAAIREVHRILEPGGRFVLGDIITRVRLPEEYAAVWTGTTAHTLN
SFTALVSEAGFEILEVTDLTAQTRCMVSWYVDELLRKLDELAGVEPAAVGTYQQRYLGDI
AAKHGPGPAQLIAAVAEYRKHPDYARNEESMGFMLLQARKKQS
selected fasta
>cyclase [methyltransferase-like protein]
GTGGAGTCCATCTTCGATGCGTTGGCGCACGGGCGTCCCCTGCACCACGGTTACTGGGCG
GGCGGGTATCGGGAGGATGCCGGTGCCACACCGTGGTCGGATGCTGCCGACCAACTGACC
GACCTGTTCATCGACAAGGCCGCGCTCCGTCCCGGAGCGCACCTGTTCGACCTGGGCTGC
GGCAATGGGCAGCCCGTAGTCCGTGCGGCATGCGCCAGCGGCGTTCGAGTCACCGGAATC
ACCGTGAACGCCCAGCATCTCGCCGCCGCCACCAGGCTCGCCAACGAGACCGGACTGGCC
GGCAGTCTTGAGTTCGATCTAGTCGACGGCGCCCAGCTGCCCTACCCGGACGGTTTCTTT
CAGGCCGCATGGGCGATGCAGTCCGTCGTGCAGATCGTGGACCAGGCCGCCGCGATCCGC
GAGGTCCACCGAATCCTGGAACCCGGCGGCCGGTTCGTCCTCGGAGACATCATCACTCGG
GTTCGACTCCCGGAAGAGTACGCGGCGGTTTGGACGGGCACGACCGCCCATACCTTGAAC
AGCTTCACGGCGCTGGTCAGCGAAGCCGGGTTCGAGATTCTCGAAGTCACCGACCTCACG
GCACAGACCAGGTGCATGGTCTCCTGGTACGTCGACGAGTTGCTCCGGAAACTCGATGAG
CTCGCCGGCGTCGAGCCTGCGGCTGTCGGCACCTACCAGCAACGCTACTTGGGAGACATC
GCGGCGAAGCACGGACCGGGACCAGCACAGCTGATCGCCGCGGTTGCGGAATACCGGAAA
CATCCGGATTACGCCAGAAACGAGGAAAGCATGGGTTTCATGCTCCTGCAGGCTCGAAAG
AAGCAGTCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [57-154]  3.7e-16 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit