close all open/close all

CDS information : Spino_00110


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction14,785 / 13,592 / - [in whole cluster]
14,785 / 13,592 / - [in contig]
Locationcomplement(13592..14785) [in whole cluster]
complement(13592..14785) [in contig]
TypeCDS
Length1,194 bp (397 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
ProductL-rhamnose C-3' O-methyltransferase
Product (GenBank)probable O-methyltransferase
Gene
Gene (GenBank)spnK
EC number2.1.1.-
Keyword
  • tri-O-methylrhamnose
Note
Note (GenBank)
  • probably involved in rhamnose O-methylation
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[20158237] Biosynthesis of spinosyn in Saccharopolyspora spinosa: synthesis of permethylated rhamnose and characterization of the functions of SpnH, SpnI, and SpnK. (J Am Chem Soc. , 2010)

close this sectionSequence

selected fasta
>L-rhamnose C-3' O-methyltransferase [probable O-methyltransferase]
MSTTHEIETVERIILAAGSSAASLADLTTELGLARIAPVLIDEILFRAEPAPDIERTEVA
VQITHRGETVDFVLTLQSGELIKAEQRPVGDVPLRIGYELTDLIAELFGPGAPRAVGARS
TNFLRTTTSGSIPGPSELSDGFQAISAVVAGCGHRRPDLNLLASHYRTDKWGGLHWFTPL
YERHLGEFRDRPVRILEIGVGGYNFDGGGGESLKMWKRYFHRGLVFGMDVFDKSFLDQQR
LCTVRADQSKPEELAAVDDKYGPFDIIIDDGSHINGHVRTSLETLFPRLRSGGVYVIEDL
WTTYAPGFGGQAQCPAAPGTTVSLLKNLLEGVQHEEQPHAGSYEPSYLERNLVGLHTYHN
IAFLEKGVNAEGGVPAWVPRSLDDILHLADVNSAEDE
selected fasta
>L-rhamnose C-3' O-methyltransferase [probable O-methyltransferase]
ATGTCCACAACGCACGAGATCGAAACCGTGGAACGCATCATCCTCGCCGCCGGATCCAGT
GCGGCGAGCCTGGCCGACCTGACCACCGAACTCGGACTCGCCAGGATCGCACCCGTGCTG
ATCGACGAGATCCTCTTCCGCGCGGAACCGGCCCCCGACATCGAACGGACCGAGGTCGCG
GTCCAGATCACCCACCGAGGCGAGACCGTTGACTTCGTCCTGACGCTACAGTCCGGTGAG
CTGATCAAGGCCGAGCAACGACCGGTCGGAGACGTCCCGCTGCGGATCGGTTACGAGCTC
ACCGATCTCATCGCCGAGTTGTTCGGCCCAGGAGCTCCCAGGGCCGTCGGCGCCCGGAGC
ACCAACTTCCTCCGAACCACCACATCCGGTTCGATACCCGGTCCGTCGGAACTGTCCGAT
GGCTTCCAGGCCATCTCCGCAGTGGTCGCCGGCTGCGGGCACCGACGTCCCGACCTCAAC
TTGCTCGCCTCCCACTACCGCACGGACAAGTGGGGCGGCCTGCACTGGTTCACCCCGCTA
TACGAGCGACACCTCGGCGAGTTCCGTGATCGCCCGGTGCGCATCCTGGAGATCGGTGTC
GGTGGCTACAACTTCGACGGTGGCGGCGGCGAATCCCTGAAGATGTGGAAGCGCTACTTC
CACCGCGGCCTCGTGTTCGGGATGGACGTTTTCGACAAGTCCTTCCTCGACCAGCAGAGG
CTCTGCACCGTCCGCGCCGACCAGAGCAAGCCCGAGGAGCTGGCCGCCGTTGACGACAAG
TACGGACCGTTCGACATCATCATCGACGATGGCAGCCACATCAACGGACACGTGCGCACA
TCCCTGGAAACGCTGTTCCCCCGGTTGCGCAGCGGTGGCGTATACGTGATCGAGGATCTG
TGGACGACCTATGCTCCCGGATTCGGCGGGCAGGCGCAGTGCCCGGCCGCACCCGGCACC
ACGGTCAGCCTGCTCAAGAACCTGTTGGAAGGCGTTCAGCACGAGGAGCAGCCGCATGCG
GGCTCGTACGAGCCGAGCTACCTGGAACGCAATTTGGTCGGCCTCCACACCTACCACAAC
ATCGCGTTCCTGGAGAAAGGCGTCAACGCCGAAGGCGGCGTTCCTGCTTGGGTGCCAAGG
AGTCTGGACGACATATTGCACCTGGCCGACGTGAACAGCGCGGAGGACGAGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
No significant hit
SignalP No significant hit
TMHMM No significant hit