close all open/close all

CDS information : Spino_00150


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction19,713 / 18,541 / - [in whole cluster]
19,713 / 18,541 / - [in contig]
Locationcomplement(18541..19713) [in whole cluster]
complement(18541..19713) [in contig]
TypeCDS
Length1,173 bp (390 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category2.3 modification addition of sugar moiety
Productglycosyltransferase
Product (GenBank)probable NDP-rhamnosyltransferase
Gene
Gene (GenBank)spnG
EC number
Keyword
  • L-rhamnose
Note
Note (GenBank)
  • involved in rhamnose addition
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[19126547] Functional characterization and substrate specificity of spinosyn rhamnosyltransferase by in vitro reconstitution of spinosyn biosynthetic enzymes. (J Biol Chem. , 2009)
[21544146] Enzyme-catalysed [4+2] cycloaddition is a key step in the biosynthesis of spinosyn A. (Nature. , 2011)
[22283226] Structural studies of the spinosyn rhamnosyltransferase, SpnG. (Biochemistry. , 2012)

close this sectionSequence

selected fasta
>glycosyltransferase [probable NDP-rhamnosyltransferase]
MRVLVVPLPYPTHLMAMVPLCWALQASGHEVLIAAPPELQATAHGAGLTTAGIRGNDRTG
DTGGTTQLRFPNPAFGQRDTEAGRQLWEQTASNVAQSSLDQLPEYLRLAEAWRPSVLLVD
VCALIGRVLGGLLDLPVVLHRWGVDPTAGPFSDRAHELLDPVCRHHGLTGLPTPELILDP
CPPSLQASDAPQGAPVQYVPYNGSGAFPAWGAARTSARRVCICMGRMVLNATGPAPLLRA
VAAATELPGVEAVIAVPPEHRALLTDLPDNARIAESVPLNLFLRTCELVICAGGSGTAFT
ATRLGIPQLVLPQYFDQFDYARNLAAAGAGICLPDEQAQSDHEQFTDSIATVLGDTGFAS
AAIKLSDEITAMPHPAALVRTLENTAAIRA
selected fasta
>glycosyltransferase [probable NDP-rhamnosyltransferase]
ATGCGCGTACTCGTCGTTCCCTTGCCCTATCCGACGCATCTCATGGCAATGGTGCCGCTG
TGCTGGGCGCTGCAAGCATCCGGGCACGAGGTCCTGATCGCCGCACCACCAGAGCTGCAG
GCGACCGCGCATGGTGCAGGTCTCACCACGGCCGGGATCCGCGGGAACGACAGGACCGGC
GATACGGGTGGAACCACGCAGCTGCGCTTTCCCAATCCGGCGTTCGGTCAGCGCGACACC
GAGGCAGGCCGGCAACTGTGGGAGCAGACCGCGTCCAATGTCGCGCAAAGCTCGCTCGAT
CAGCTCCCCGAATACCTTCGACTGGCCGAGGCCTGGCGACCGTCAGTGCTGTTGGTCGAC
GTCTGCGCGCTGATCGGCCGGGTGCTCGGCGGATTGCTCGACCTGCCGGTCGTGCTGCAC
CGCTGGGGAGTCGACCCCACCGCAGGCCCCTTCAGCGATCGAGCCCACGAGTTGCTTGAC
CCGGTGTGCCGGCACCACGGACTGACCGGCCTGCCCACTCCCGAGCTCATCCTCGATCCC
TGTCCGCCGAGCCTGCAAGCAAGCGACGCGCCGCAAGGCGCACCGGTCCAGTACGTGCCG
TACAACGGAAGCGGCGCATTCCCGGCATGGGGCGCGGCGCGCACCTCAGCACGGCGGGTC
TGCATCTGCATGGGCCGCATGGTGCTGAACGCCACCGGGCCGGCTCCGCTGCTGCGCGCA
GTAGCGGCTGCCACCGAGTTGCCCGGCGTCGAGGCCGTGATCGCCGTTCCCCCCGAGCAC
CGGGCACTTCTCACCGACCTACCCGACAACGCCCGGATCGCCGAATCGGTCCCGCTCAAC
CTGTTCCTGCGTACCTGCGAGCTGGTCATCTGCGCGGGCGGCTCGGGAACGGCATTCACC
GCGACCCGACTCGGCATCCCGCAACTCGTGCTTCCCCAGTACTTCGACCAGTTCGACTAC
GCGCGCAACCTCGCCGCTGCCGGGGCGGGCATCTGCTTGCCGGATGAGCAGGCCCAGTCC
GACCACGAACAGTTCACCGACTCAATCGCAACGGTGCTCGGCGACACCGGCTTCGCTTCT
GCGGCAATCAAACTCAGCGACGAGATCACGGCCATGCCCCATCCCGCCGCGCTGGTGCGG
ACACTGGAGAACACTGCGGCCATCCGTGCCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR004276 Glycosyl transferase, family 28 (Domain)
 [13-90]  6.90000000000001e-07 PF03033
PF03033   Glyco_transf_28
IPR010610 Domain of unknown function DUF1205 (Domain)
 [178-272]  4.2e-23 PF06722
PF06722   DUF1205
SignalP
 [1-23]  0.521 Signal
Bacteria, Gram-negative   
 [1-28]  0.966 Signal
Eukaryota   
 [1-34]  0.435 Signal
Bacteria, Gram-positive   
TMHMM No significant hit