close all open/close all

CDS information : Spino_00160


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction20,168 / 20,995 / + [in whole cluster]
20,168 / 20,995 / + [in contig]
Location20168..20995 [in whole cluster]
20168..20995 [in contig]
TypeCDS
Length828 bp (275 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category3.4 other modification
Productcyclase
Product (GenBank)methyltransferase-like protein
Gene
Gene (GenBank)spnF
EC number
Keyword
  • C-4 and C-12
  • C-7 and C-11
Note
Note (GenBank)
  • possibly involved in polyketide bridging; involved in spinosyn aglycone biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[21544146] Enzyme-catalysed [4+2] cycloaddition is a key step in the biosynthesis of spinosyn A. (Nature. , 2011)
[25730549] The structure of SpnF, a standalone enzyme that catalyzes [4 + 2] cycloaddition. (Nat Chem Biol. , 2015)
[26495876] Natural Diels-Alderases: Elusive and Irresistable. (J Org Chem. , 2015)
[26909570] Dynamically Complex [6+4] and [4+2] Cycloadditions in the Biosynthesis of Spinosyn A. (J Am Chem Soc. , 2016)

close this sectionSequence

selected fasta
>cyclase [methyltransferase-like protein]
MLPGGAPTSQQVGQMYDLVTPLLNSVAGGPCAIHHGYWENDGRASWQQAADRLTDLVAER
TVLDGGVRLLDVGCGTGQPALRVARDNAIQITGITVSQVQVAIAADCARERGLSHRVDFS
CVDAMSLPYPDNAFDAAWAMQSLLEMSEPDRAIREILRVLKPGGILGVTEVVKREAGGGM
PVSGDRWPTGLRICLAEQLLESLRAAGFEILDWEDVSSRTRYFMPQFAEELAAHQHGIAD
RYGPAVAGWAAAVCDYEKYAHDMGYAILTARKPVG
selected fasta
>cyclase [methyltransferase-like protein]
GTGTTGCCAGGTGGCGCACCAACATCGCAGCAGGTTGGGCAGATGTATGACCTGGTCACG
CCGTTGCTGAACTCGGTCGCGGGCGGCCCCTGCGCCATCCACCACGGCTACTGGGAGAAC
GACGGGCGGGCTTCCTGGCAGCAGGCCGCCGACCGGCTCACCGACCTTGTCGCCGAACGG
ACCGTGCTCGATGGCGGCGTTCGACTGCTCGATGTGGGGTGCGGTACCGGACAACCAGCG
CTGCGCGTCGCGCGCGACAACGCGATCCAGATCACCGGCATCACCGTCAGCCAGGTGCAA
GTGGCCATCGCCGCTGATTGCGCACGCGAACGCGGACTAAGCCACCGGGTGGACTTCTCG
TGCGTCGATGCCATGTCCCTGCCGTACCCGGACAATGCTTTCGACGCCGCCTGGGCCATG
CAGTCGCTGTTGGAGATGTCCGAACCGGACCGTGCCATCCGGGAAATCCTTCGAGTACTC
AAACCCGGTGGCATCCTCGGCGTCACCGAGGTCGTCAAACGAGAAGCGGGCGGCGGGATG
CCGGTGTCCGGGGACAGGTGGCCGACCGGCCTTCGGATCTGCCTGGCTGAGCAACTTCTG
GAATCGCTGCGTGCAGCGGGGTTCGAGATCCTCGATTGGGAGGACGTGTCGTCGAGGACC
CGGTACTTCATGCCGCAGTTCGCCGAAGAGCTCGCTGCGCACCAGCACGGGATCGCGGAC
AGGTACGGGCCGGCTGTCGCCGGCTGGGCCGCCGCGGTCTGCGATTATGAGAAATATGCC
CACGACATGGGCTATGCGATTCTGACGGCGCGGAAGCCGGTCGGCTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR013216 Methyltransferase type 11 (Domain)
 [70-166]  1.8e-22 PF08241
PF08241   Methyltransf_11
SignalP No significant hit
TMHMM No significant hit