close all open/close all

CDS information : Spino_00170


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction21,111 / 28,898 / + [in whole cluster]
21,111 / 28,898 / + [in contig]
Location21111..28898 [in whole cluster]
21111..28898 [in contig]
TypeCDS
Length7,788 bp (2,595 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase loading and extender module 1
Gene
Gene (GenBank)spnA
EC number
Keyword
Note
Note (GenBank)
  • involved in spinosyn aglycone biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[14685317] Heterologous expression in Saccharopolyspora erythraea of a pentaketide synthase derived from the spinosyn polyketide synthase. (Org Biomol Chem. , 2003)

close this sectionPKS/NRPS Module

0 methylmalonyl-CoA
1 malonyl-CoA
KSQ8..375
AT527..844
ACP907..977
KS997..1366
AT1525..1846
KR2160..2339
ACP2444..2514

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase loading and extender module 1]
MSEAGNLIAVIGLSCRLPQAPDPASFWRLLRTGTDAITTVPEGRWGDPLPGRDAPKGPEW
GGFLADVDCFDPEFFGISPREAATVDPQQRLALELAWEALEDAGIPAGELRGTAAGVFMG
AISDDYAALLRESPPEVAAQYRLTGTHRSLIANRVSYVLGLRGPSLTVDSGQSSSLVGVH
LASESLRRGECTIALAGGVNLNLAAESNSALMDFGALSPDGRCFTFDVRANGYVRGEGGG
LVVLKKADQAHADGDRIYCLIRGSAVNNDGGGAGLTVPAADAQAELLRQAYRNAGVDPAA
VQYVELHGSATRVGDPVEAAALGAVLGAARRPGDELRVGSAKTNVGHLEAAAGVTGLLKT
ALSIWHRELPPSLHFTAPNPEIPLDELNLRVQRDLRPWPESEGPLLAGVSAFGMGGTNCH
LVLSGTSRVERRRSGPAEATMPWVLSARTPVALRAQAARLHTHLNTAGQSPLDVAYSLAT
TRSALPHRAALVADDEPKLLAGLKALADGDDAPTLCHGATSGERAAVFVFPGQGSQWIGM
GRQLLETSEVFAASMSDCADALAPHLDWSLLDVLRNAAGAAHLDHDDVVQPALFAIMVSL
AELWRSWGVRPVAVVGHSQGEIAAACVAGALSVRDAARVVAVRSRLLTALAGSGAMASLQ
HPAEEVRQILLPWRDRIGVAGVNGPSSTLVSGDREAMAELLAECADRELRMRRIPVEYAS
HSPHIEVVRDELLGLLAPVEPRTGSIPIYSTTTGDLLDRPMDADYWYRNLRQPVLFEAAV
EALLKRGYDAFIEISPHPVLTANIQETAVRAGREVVALGTLRRGEGGMRQALTSLARAHV
HGVAADWHAVFAGTGAQRVDLPTYAFQRQRYWLDAKLPDVAMPESDVSTALREKLRSSPR
ADVDSTTLTMIRAQAAVVLGHSDPKEVDPDRTFKDLGFDSSMVVELCDRLNAATGLRLAP
SVVFDCPTPDKLARQVRTLLLGEPAPMTSHRPDSDADEPIAVIGMGCRFPGGVSSPEELW
QLVAAGRDVVSEFPADRGWDLERAGTSHVRAGGFLHGAPDFDPGFFRISPREALAMDPQQ
RLLLEIAWEAVERGGINPQHLHGSQTGVFVGATSLDYGPRLHEASEEAAGYVLTGSTTSV
ASGRVAYSFGFEGPAVTVDTACSSSLVALHLACQSLRSGECDLALAGGVTVMATPGMFVE
FSRQRGLAPDGRCKSFAEAADGTGWSEGAGLVLLERLSDARRNGHEVLAVVRGSAVNQDG
ASNGLTAPNGSSQQRVIAQALASAGLSVSDVDAVEAHGTGTRLGDPIEAQALIATYGQGR
LPERPLWLGSMKSNIGHAQAAAGIAGVMKMVMAMRHGQLPRTLHVDEPTSGVDWSAGTVQ
LLTENTPWPGSGRVRRVGVSSFGISGTNAHVILEQPPGVPSQSAGPGSGSVVDVPVVPWM
VSGKTPEALSAQATALMTYLDERPDVSSLDVGYSLALTRSALDERAVVLGSDRETLLCGV
KALSAGHEASGLVTGSVGAGGRIGFVFSGQGGQWLGMGRGLYRAFPVFAAAFDEACAELD
AHLGQEIGVREVVSGSDAQLLDRTLWAQSGLFALQVGLLKLLDSWGVRPSVVLGHSVGEL
AAAFAAGVVSLSGAARLVAGRARLMQALPSGGGMLAVPAGEELLWSLLADQGDRVGIAAV
NAAGSVVLSGDRDVLDDLAGRLDGQGIRSRWLRVSHAFHSYRMDPMLAEFAELARTVDYR
RCEVPIVSTLTGDLDDAGRMSGPDYWVRQVREPVRFADGVQALVEHDVATVVELGPDGAL
SALIQECVAASDHAGRLSAVPAMRRNQDEAQKVMTALAHVHVRGGAVDWRSFFAGTRAKQ
IELPTYAFQRQRYWLNALRESSAGDMGRRVEAKFWGAVEHEDVESLARVLGIVDDGAAVD
SLRSALPVLAGWQRTRTTESIMDQRCYRIGWRQVAGLPPMGTVFGTWLVFAPHGWSSEPE
VVDCVTALRARGASVVLVEADPDPTSFGDRVRTLCSGLPDLVGVLSMLCLEESVLPGFSA
VSRGFALTVELVRVLRAAGATARLWLLTCGGVSVGDVPVRPAQALAWGLGRVVGLEHPDW
WGGLIDIPVLFDEDAQERLSIVLAGLDEDEVAIRPDGMFARRLVRHTVSADVKKAWRPRG
SVLVTGGTGGLGAHVARWLADAGAEHVAMVSRRGEQAPSAEKLRTELEDLGTRVSIVSCD
VTDREALAEVLKALPAENPLTAVVHAAGVIETGDAAAMSLADFDHVLSAKVAGAANLDAL
LADVELDAFVLFSSVSGVWGAGGHGAYAAANAYLDALAEQRRSRGLVATAVAWGPWAGEG
MASGETGDQLRRYGLSPMAPQHAIAGIRQAVEQDEISLVVADVDWARFSAGLLAARPRPL
LNELAEVKELLVDAQPEAGVLADASLEWRQRLSAAPRPTQEQLILELVRGETALVLGHPG
AAAVASERAFKDSGFDSQAAVELRVRLNRATGLQLPSTIIFSHPTPAELAAELRARLLPE
SAGAGIPEEDEARIRAALTSIPFPALREAGLVSPLLALAGHPVDSGISSDDAAATSIDAM
DVAGLVEAALGERES
selected fasta
>polyketide synthase [polyketide synthase loading and extender module 1]
ATGAGCGAAGCCGGGAACCTGATAGCCGTCATCGGACTGTCCTGCCGCCTACCCCAGGCG
CCTGACCCGGCTTCCTTCTGGCGGTTGCTGCGCACCGGAACGGACGCCATCACCACGGTC
CCGGAAGGGCGGTGGGGCGACCCGTTGCCTGGTCGGGATGCGCCCAAGGGCCCGGAATGG
GGTGGTTTCCTGGCTGATGTCGACTGCTTCGATCCCGAGTTCTTCGGGATCTCGCCGCGA
GAAGCGGCAACCGTGGATCCCCAGCAGAGGCTGGCTCTGGAGCTCGCCTGGGAGGCACTC
GAAGACGCCGGTATCCCCGCCGGCGAGCTGCGCGGTACTGCCGCCGGTGTGTTCATGGGG
GCGATCTCTGACGACTACGCCGCCCTGCTGCGCGAGAGCCCGCCGGAAGTGGCTGCGCAG
TACCGCCTCACCGGCACCCATCGAAGCCTGATCGCCAACCGCGTGTCCTATGTGCTCGGC
CTGCGCGGGCCAAGCCTGACGGTGGATTCAGGTCAGTCCTCGTCCCTGGTCGGCGTGCAT
CTCGCCAGCGAGAGCCTGCGACGGGGTGAGTGCACGATCGCACTCGCCGGCGGCGTGAAC
CTCAACCTGGCCGCCGAGAGCAACAGCGCTCTGATGGACTTCGGCGCGCTCTCCCCGGAC
GGTCGCTGCTTCACCTTCGATGTGCGGGCGAACGGTTACGTCCGTGGTGAGGGCGGCGGC
CTTGTCGTGCTGAAGAAGGCCGATCAGGCGCACGCCGATGGCGACCGGATCTACTGCCTC
ATCCGCGGCAGCGCGGTCAACAACGATGGGGGCGGTGCCGGGCTCACCGTTCCGGCGGCG
GACGCCCAGGCGGAGCTGCTGCGCCAGGCATACCGGAACGCGGGCGTCGACCCGGCCGCC
GTGCAGTATGTCGAGCTCCACGGCAGCGCGACCAGGGTCGGGGATCCCGTCGAAGCAGCA
GCCCTCGGAGCTGTCCTGGGGGCGGCGAGACGGCCCGGCGACGAGCTGCGTGTGGGGTCG
GCGAAGACCAACGTCGGCCATCTGGAAGCAGCGGCGGGCGTCACCGGGTTGCTGAAGACC
GCACTCAGCATCTGGCACCGCGAACTGCCGCCGAGTCTTCATTTCACCGCCCCCAACCCG
GAAATCCCGCTGGACGAATTGAACCTACGCGTCCAGCGTGATCTGCGGCCGTGGCCGGAG
AGCGAGGGGCCGCTGCTGGCCGGCGTCAGCGCCTTCGGAATGGGAGGCACGAACTGCCAC
CTGGTGCTCTCCGGCACGTCCCGGGTGGAGCGACGGCGCAGTGGACCCGCTGAGGCGACC
ATGCCGTGGGTCTTGTCGGCCAGAACACCGGTCGCATTGCGTGCGCAGGCGGCGCGCTTG
CACACGCACCTCAATACGGCCGGTCAAAGTCCGTTGGACGTCGCCTACTCACTGGCGACC
ACTCGATCCGCGCTACCGCACCGGGCCGCGCTGGTCGCGGACGACGAACCGAAACTGCTC
GCCGGGTTGAAGGCCCTCGCTGACGGCGACGACGCGCCCACGCTGTGCCACGGCGCGACT
TCCGGCGAGCGGGCAGCGGTCTTCGTCTTTCCCGGACAGGGCAGCCAGTGGATCGGGATG
GGTAGGCAGCTGCTCGAAACCTCCGAGGTTTTCGCGGCGTCGATGTCGGACTGCGCCGAC
GCATTGGCGCCACACCTGGATTGGTCCCTGCTGGATGTGCTGCGCAACGCGGCCGGCGCT
GCGCACCTTGACCACGACGATGTCGTCCAGCCCGCGCTGTTCGCCATCATGGTCTCGCTC
GCGGAGCTCTGGCGTTCGTGGGGCGTGCGTCCGGTGGCGGTCGTCGGGCACTCGCAGGGG
GAGATCGCGGCGGCCTGCGTCGCCGGGGCCCTGTCCGTCCGCGATGCCGCCAGGGTGGTG
GCGGTGCGCAGCAGGCTTCTGACGGCGCTGGCCGGCAGTGGCGCGATGGCCTCGTTGCAG
CATCCCGCCGAAGAGGTGCGGCAAATCCTGTTGCCCTGGCGCGATCGGATCGGCGTGGCG
GGGGTGAACGGACCGTCGTCGACCCTGGTGTCAGGGGACCGGGAGGCGATGGCGGAACTG
CTGGCCGAGTGCGCAGACCGAGAGCTCCGGATGCGCCGGATTCCCGTTGAATACGCCTCC
CATTCGCCTCACATCGAGGTTGTCCGGGATGAGCTGCTGGGGCTGTTGGCGCCGGTCGAA
CCCAGGACGGGAAGCATCCCGATCTATTCGACGACGACCGGGGACCTGCTGGACCGGCCG
ATGGACGCCGACTACTGGTACCGCAACCTTCGTCAACCGGTGCTGTTCGAAGCGGCCGTC
GAGGCCCTGTTGAAGCGGGGGTACGACGCATTCATCGAGATCAGCCCACACCCGGTGCTG
ACTGCGAACATCCAGGAAACCGCCGTGCGAGCAGGGCGGGAGGTAGTGGCGCTCGGGACA
CTCCGCCGCGGCGAAGGTGGCATGCGGCAGGCGCTGACGTCGCTGGCCAGAGCACACGTA
CACGGAGTGGCCGCGGACTGGCACGCGGTCTTCGCCGGTACCGGGGCGCAGCGGGTCGAC
CTGCCGACGTACGCCTTTCAGCGACAGCGCTACTGGCTGGACGCGAAGCTTCCCGACGTC
GCCATGCCCGAGAGCGACGTGTCGACGGCGTTGCGGGAAAAGCTGCGGTCTTCGCCGAGG
GCGGACGTGGACTCGACGACCCTCACGATGATCCGGGCACAGGCAGCCGTGGTCCTCGGC
CACTCCGATCCGAAAGAGGTGGACCCGGATCGGACGTTCAAGGACCTGGGCTTCGATTCC
TCGATGGTGGTCGAGCTGTGCGACCGCCTAAACGCCGCCACAGGTCTGCGACTCGCACCG
AGCGTCGTTTTCGACTGTCCTACGCCGGACAAGCTCGCCCGCCAGGTACGGACGTTGTTG
TTGGGCGAGCCGGCTCCCATGACGTCACACCGGCCGGACTCCGATGCGGACGAGCCTATC
GCCGTGATCGGGATGGGCTGTCGGTTTCCGGGTGGGGTGTCCTCGCCCGAGGAGTTGTGG
CAGTTGGTCGCCGCTGGGCGGGACGTCGTGTCCGAGTTCCCGGCTGACCGAGGTTGGGAC
CTGGAGCGTGCGGGGACATCGCACGTGCGCGCCGGCGGGTTCTTGCATGGCGCCCCGGAT
TTTGACCCCGGGTTCTTCCGGATTTCGCCGCGCGAGGCGTTGGCGATGGATCCACAGCAG
CGGTTGCTGCTGGAAATCGCCTGGGAAGCAGTCGAACGAGGCGGGATCAACCCGCAGCAC
CTGCACGGAAGTCAAACCGGGGTCTTCGTCGGCGCGACCTCCCTGGACTACGGGCCACGC
CTGCACGAAGCGTCCGAGGAGGCGGCCGGGTACGTGCTCACCGGCAGCACCACGAGTGTG
GCGTCGGGTCGGGTTGCGTATTCGTTCGGGTTCGAGGGCCCTGCGGTGACGGTGGATACG
GCGTGTTCGTCGTCGTTGGTGGCCCTGCATTTGGCGTGTCAGTCGTTGCGTTCGGGTGAG
TGTGATCTGGCGTTGGCCGGTGGTGTGACCGTGATGGCCACGCCGGGGATGTTCGTGGAG
TTTTCGCGGCAGCGTGGTTTGGCGCCGGATGGGCGGTGCAAGTCGTTCGCGGAGGCCGCC
GACGGCACCGGCTGGTCCGAGGGTGCTGGCCTGGTTCTACTGGAGCGGTTGTCGGATGCC
CGGCGGAATGGGCATGAGGTGCTGGCGGTTGTTCGTGGTAGTGCGGTGAATCAGGACGGT
GCGTCGAATGGTTTGACCGCGCCGAATGGTTCGTCGCAGCAGCGGGTGATTGCCCAGGCA
TTGGCGAGTGCGGGGTTGTCGGTGTCCGATGTGGATGCTGTGGAGGCGCATGGGACGGGC
ACGCGGCTTGGTGATCCGATCGAGGCGCAGGCGCTGATCGCCACCTACGGCCAGGGCCGG
CTTCCGGAACGGCCATTGTGGTTGGGCTCGATGAAGTCGAACATCGGTCACGCGCAGGCA
GCTGCGGGGATAGCCGGCGTCATGAAGATGGTGATGGCGATGCGGCACGGGCAGCTACCG
CGCACGTTGCACGTGGATGAGCCGACTTCTGGGGTGGATTGGTCGGCGGGGACGGTTCAA
CTCCTTACGGAGAACACGCCCTGGCCCGGGAGTGGTCGTGTTCGTCGGGTGGGGGTGTCG
TCGTTCGGGATCAGTGGTACTAACGCGCACGTCATCCTCGAACAGCCCCCGGGAGTGCCG
AGTCAGTCTGCGGGGCCGGGTTCGGGCTCTGTCGTGGATGTTCCGGTGGTGCCGTGGATG
GTGTCGGGCAAAACACCCGAAGCGCTATCCGCGCAGGCAACGGCGTTGATGACCTATCTG
GACGAGCGACCTGATGTCTCCTCGCTGGATGTTGGGTACTCGCTGGCGTTGACACGGTCG
GCGCTGGATGAGCGAGCGGTGGTGCTGGGGTCGGACCGTGAAACGTTGTTGTGCGGTGTG
AAAGCGCTGTCTGCCGGTCATGAGGCTTCTGGGTTGGTGACCGGATCTGTGGGGGCTGGG
GGCCGCATCGGGTTTGTGTTTTCCGGTCAGGGTGGTCAGTGGCTGGGGATGGGCCGGGGG
CTTTACCGGGCTTTTCCGGTGTTCGCTGCTGCCTTTGACGAAGCTTGTGCCGAGCTGGAT
GCGCATCTGGGCCAGGAAATCGGGGTTCGGGAGGTGGTGTCCGGTTCGGATGCGCAGTTG
CTGGATCGGACGTTGTGGGCGCAGTCGGGTTTGTTCGCGTTGCAGGTGGGCTTGCTGAAG
TTGCTGGATTCGTGGGGGGTTCGGCCGAGTGTGGTGTTGGGGCATTCGGTGGGCGAGTTG
GCGGCGGCGTTCGCGGCGGGTGTGGTGTCGTTGTCGGGTGCGGCTCGGTTGGTGGCGGGT
CGTGCCCGGTTGATGCAGGCGTTGCCGTCTGGCGGTGGGATGCTGGCGGTGCCTGCTGGT
GAGGAGCTGTTGTGGTCGTTGTTGGCCGATCAGGGTGATCGTGTGGGGATCGCCGCGGTC
AACGCTGCGGGGTCGGTGGTGCTCTCTGGTGATCGGGATGTGCTCGATGACCTTGCCGGT
CGGCTGGACGGGCAAGGGATCCGGTCGAGGTGGTTGCGGGTGTCGCATGCGTTTCATTCG
TATCGGATGGATCCGATGCTGGCGGAGTTCGCCGAATTGGCACGAACCGTGGATTACCGG
CGTTGTGAAGTGCCGATCGTGTCGACCTTGACCGGAGACCTCGATGACGCTGGCAGGATG
AGCGGGCCCGACTACTGGGTGCGTCAGGTGCGAGAGCCGGTCCGCTTCGCCGACGGTGTC
CAGGCGCTGGTCGAGCACGATGTGGCCACCGTTGTCGAGCTCGGTCCGGACGGGGCGTTG
TCGGCGCTGATCCAGGAATGTGTCGCCGCATCCGATCACGCCGGGCGGCTGAGCGCGGTC
CCGGCGATGCGCAGGAACCAGGACGAGGCGCAGAAGGTGATGACGGCCCTGGCACACGTC
CACGTACGTGGTGGTGCGGTGGACTGGCGGTCGTTCTTCGCCGGTACAAGGGCGAAGCAA
ATCGAGCTGCCCACCTACGCCTTCCAACGACAGCGGTACTGGCTGAACGCGCTGCGTGAA
TCTTCCGCCGGCGACATGGGCAGGCGTGTCGAAGCGAAGTTCTGGGGCGCCGTCGAGCAC
GAAGATGTGGAATCGCTTGCACGCGTATTGGGCATTGTGGACGACGGCGCTGCTGTGGAT
TCCCTGAGAAGCGCCCTTCCGGTGTTGGCCGGTTGGCAGCGAACCCGCACCACCGAGTCC
ATTATGGATCAGCGGTGTTACCGAATTGGCTGGCGGCAGGTAGCCGGACTCCCGCCGATG
GGAACTGTTTTCGGTACCTGGCTGGTCTTCGCGCCTCATGGCTGGTCCAGCGAACCGGAG
GTGGTGGACTGCGTTACGGCACTGCGGGCACGTGGTGCCTCGGTGGTGTTGGTGGAAGCT
GATCCCGACCCGACCTCCTTCGGCGACCGGGTACGAACCCTGTGTTCGGGCCTTCCGGAT
CTTGTTGGCGTGTTGTCAATGTTGTGCTTGGAAGAATCGGTCCTTCCGGGATTTTCTGCG
GTGTCACGGGGTTTTGCGTTGACCGTGGAGTTGGTGCGGGTTTTGCGGGCAGCTGGTGCG
ACTGCCCGGTTGTGGTTGCTGACGTGTGGTGGCGTGTCGGTGGGAGATGTACCGGTTCGT
CCAGCGCAGGCCCTGGCGTGGGGGTTGGGGCGTGTTGTGGGGTTGGAGCATCCGGACTGG
TGGGGCGGCTTGATCGATATTCCGGTCTTGTTCGACGAAGACGCTCAAGAGCGGTTGTCG
ATTGTGCTGGCAGGTCTCGATGAGGACGAGGTCGCGATCCGTCCTGACGGCATGTTCGCG
CGTCGGTTGGTACGCCACACTGTCTCAGCTGATGTGAAGAAGGCGTGGCGCCCCAGGGGA
TCGGTGCTGGTGACGGGCGGCACGGGTGGTTTGGGGGCGCACGTTGCTCGCTGGCTGGCC
GACGCCGGAGCCGAACATGTGGCGATGGTGAGTCGACGCGGCGAGCAGGCACCGAGTGCT
GAGAAGTTGCGGACGGAACTGGAGGATCTGGGTACCCGGGTGTCGATCGTGTCATGCGAT
GTGACCGATCGCGAGGCGCTCGCCGAAGTGCTGAAAGCCCTTCCGGCTGAAAACCCGTTG
ACCGCGGTAGTGCATGCGGCAGGCGTGATCGAGACTGGTGATGCGGCGGCAATGAGCCTG
GCTGATTTCGATCACGTGTTGTCCGCAAAGGTGGCCGGTGCCGCGAATCTGGATGCCTTG
TTGGCCGATGTGGAATTGGACGCGTTCGTCTTGTTCTCATCGGTGTCAGGAGTTTGGGGC
GCTGGGGGACACGGGGCTTACGCAGCGGCGAATGCCTATCTGGATGCGCTCGCGGAACAG
CGTCGGTCGCGAGGGCTGGTCGCGACTGCGGTGGCCTGGGGGCCGTGGGCCGGCGAGGGC
ATGGCCTCCGGAGAAACAGGAGACCAGCTGCGCCGATACGGCCTTTCCCCAATGGCTCCG
CAGCACGCCATCGCCGGAATCCGGCAGGCCGTGGAACAGGACGAAATTTCCCTGGTAGTG
GCCGATGTCGATTGGGCACGTTTCAGCGCGGGATTGCTGGCGGCTAGGCCGCGGCCGCTG
CTGAACGAACTGGCCGAGGTCAAGGAACTCCTCGTCGATGCCCAGCCCGAGGCGGGAGTC
CTTGCCGACGCGTCGTTGGAATGGCGGCAGCGATTGTCCGCGGCACCGAGGCCGACACAG
GAACAGCTGATCCTGGAGCTGGTACGCGGCGAAACCGCTCTGGTGCTGGGACACCCCGGG
GCAGCGGCCGTTGCATCGGAACGAGCCTTCAAGGACAGCGGATTCGACTCGCAGGCCGCG
GTCGAACTCCGCGTTCGGCTCAATCGAGCTACCGGCCTCCAGTTGCCATCGACAATTATC
TTCAGCCATCCCACGCCTGCGGAACTGGCTGCGGAGCTGCGGGCGAGGCTTCTTCCCGAG
TCCGCAGGAGCAGGCATTCCCGAGGAGGACGAGGCGCGAATCAGAGCGGCACTGACGTCG
ATCCCGTTCCCGGCCTTGCGCGAGGCAGGCTTGGTGAGTCCGCTGCTCGCACTTGCCGGA
CACCCGGTCGACTCCGGTATCTCCTCGGACGATGCGGCCGCGACCTCGATCGATGCGATG
GATGTAGCCGGCCTCGTCGAAGCAGCGCTGGGCGAACGCGAGTCCTGA
[0] KSQ8..375
[0] AT527..844
[0] methylmalonyl-CoA718..722
[0] ACP907..977
[1] KS997..1366
[1] AT1525..1846
[1] malonyl-CoA1716..1720
[1] KR2160..2339
[1] ACP2444..2514
[0] KSQ22..1125
[0] AT1579..2532
[0] methylmalonyl-CoA2152..2166
[0] ACP2719..2931
[1] KS2989..4098
[1] AT4573..5538
[1] malonyl-CoA5146..5160
[1] KR6478..7017
[1] ACP7330..7542

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [521-650]  G3DSA:3.40.366.10 [718-834]  G3DSA:3.40.366.10 [1520-1648]  G3DSA:3.40.366.10 [1716-1836]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [2160-2326]  7.00000000000005e-57 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [935-950]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [905-1014]  1.50000306971104e-26 SSF47336 [2436-2531]  5.39999384454126e-20 SSF47336
SSF47336   ACP_like
 [911-975]  1.1e-12 PF00550 [2452-2513]  2.7e-09 PF00550
PF00550   PP-binding
 [907-977]  PS50075 [2444-2514]  PS50075
PS50075   ACP_DOMAIN
 [906-979]  8.30000000000004e-39 G3DSA:1.10.1200.10 [2443-2517]  8.30000000000004e-39 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [8-250]  8.60000000000005e-80 PF00109 [997-1240]  4.80000000000003e-95 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [258-375]  2.80000000000001e-36 PF02801 [1248-1366]  1.2e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [527-844]  1e-108 PF00698 [1525-1846]  2.70000000000002e-65 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [525-828]  5.6999970878395e-68 SSF52151 [1522-1813]  6.90004508941104e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [652-717]  6.69999687625999e-16 SSF55048 [1650-1715]  1e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [8-261]  G3DSA:3.40.47.10 [262-426]  1.5e-120 G3DSA:3.40.47.10 [997-1251]  G3DSA:3.40.47.10 [1252-1417]  1.5e-120 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [8-374]  1.09999184471405e-82 SSF53901 [990-1364]  1.59998835313644e-102 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [2162-2340]  7.00000000000005e-41 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [1153-1169]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [529-825]  4.30000170645869e-121 SM00827 [1526-1827]  8.70005082121738e-117 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [908-980]  1.89999859865865e-29 SM00823 [2445-2517]  8.1000073432326e-29 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [8-428]  SM00825 [1000-1418]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [2160-2339]  1.10000150671643e-55 SM00822
SM00822   PKS_KR
SignalP
 [1-26]  0.298 Signal
Bacteria, Gram-positive   
TMHMM No significant hit