close all open/close all

CDS information : Spino_00180


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction28,916 / 35,374 / + [in whole cluster]
28,916 / 35,374 / + [in contig]
Location28916..35374 [in whole cluster]
28916..35374 [in contig]
TypeCDS
Length6,459 bp (2,152 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase extender module 2
Gene
Gene (GenBank)spnB
EC number
Keyword
Note
Note (GenBank)
  • probably involved in spinosyn aglycone biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[14685317] Heterologous expression in Saccharopolyspora erythraea of a pentaketide synthase derived from the spinosyn polyketide synthase. (Org Biomol Chem. , 2003)
[22634636] Divergence of multimodular polyketide synthases revealed by a didomain structure. (Nat Chem Biol. , 2012)

close this sectionPKS/NRPS Module

2 malonyl-CoA
KS37..413
AT572..893
DH940..1102
ER1413..1715
KR1725..1903
ACP2001..2071

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase extender module 2]
MTVTTSYEEVVEALRASLKENERLRRGRDRFSAEKDDPIAIVAMSCRYPGQVSSPEDLWQ
LAAGGVDAISEVPGDRGWDLDGVFVPDSDRPGTSYACAGGFLQGVSEFDAGFFGISPREA
LAMDPQQRLLLEVAWEVFERAGLEQRSTRGSRVGVFVGTNGQDYASWLRTPPPAVAGHVL
TGGAAAVLSGRVAYSFGFEGPAVTVDTACSSSLVALHLAGQALRAGECDLALAGGVTVMS
TPKVFLEFSRQRGLAPDGRCKSFAAGADGTGWGEGAGLLLLERLSDARRNGHEVLAVVRG
SAVNQDGASNGLTAPNGSSQQRVITQALASAGLSVSDVDAVEAHGTGTRLGDPIEAQALI
ATYGRDRDPGRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGQLPRTLHVESPSPEVD
WSAGTVQLLTENTPWPRSGRVRRVGVSSFGISGTNAHVILEQPPGVPSQSAGPGSGSVVD
VPVVPWMVSGKTPEALSAQATALMTYLDERPDVSSLDVGYSLALTRSALDERAVVLGSDR
ETLLCGVKALSAGHEASGLVTGSVGAGGRIGFVFSGQGGQWLGMGRGLYRAFPVFAAAFD
EACAELDAHLGQEIGVREVVSGSDAQLLDRTLWAQSGLFALQVGLLKLLDSWGVRPSVVL
GHSVGELAAAFAAGVVSLSGAARLVAGRARLMQALPSGGGMLAVPAGEELLWSLLADQGD
RVGIAAVNAAGSVVLSGDRDVLDDLAGRLDGQGIRSRWLRVSHAFHSYRMDPMLAEFAEL
ARTVDYRRCEVPIVSTLTGDLDDAGRMSGPDYWVRQVREPVRFADGVQALVEHDVATVVE
LGPDGALSALIQECVAASDHAGRLSAVPAMRRNQDEAQKVMTALAHVHVRGGAVDWRSFF
AGTGAKQIELPTYAFQRQRYWLVPSDSGDVTGAGLAGAEHPLLGAVVPVAGGDEVLLTGR
ISVRTHPWLAEHRVLGEVIVAGTALLEIALHAGERLGCERVEELTLEAPLVLPERGAIQV
QLRVGAPENSGRRPMALYSRPEGAAEHDWTRHATGRLAPGRGEAAGDLADWPAPGALPVD
LDEFYRDLAELGLEYGPIFQGLKAAWRQGDEVYAEAALPGTEDSGFGVHPALLDAALHAT
AVRDMDDARLPFQWEGVSLHAKAAPALRVRVVPAGDDAKSLLVCDGTGRPVISVDRLVLR
SAAARRTGARRQAHQARLYRLSWPTVQLPTSAQPPSCVLLGTSEVSADIQVYPDLRSLTA
ALDAGAEPPGVVIAPTPPGGGRTADVRETTRHALDLVQGWLSDQRLNESRLLLVTQGAVA
VEPGEPVTDLAQAALWGLLRSTQTEHPDRFVLVDVPEPAQLLPALPGVLACGEPQLALRR
GGAHAPRLAGLGSDDVLPVPDGTGWRLEATRPGSLDGLALVDEPTATAPLGDGEVRIAMR
AAGVNFRDALIALGMYPGVASLGSEGAGVVVETGPGVTGLAPGDRVMGMIPKAFGPLAVA
DHRMVTRIPAGWSFARAASVPIVFLTAYYALVDLAGLRPGESLLVHSAAGGVGMAAIQLA
RHLGAEVYATASEDKWQAVELSREHLASSRTCDFEQQFLGATGGRGVDVVLNSLAGEFAD
ASLRMLPRGGRFLELGKTDVRDPVEVADAHPGVSYQAFDTVEAGPQRIGEMLHELVELFE
GRVLEPLPVTAWDVRQAPEALRHLSQARHVGKLVLTMPPVWDAAGTVLVTGGTGALGAEV
ARHLVIERGVRNLVLVSRRGPAASGAAELVAQLTAYGAEVSLQACDVADRETLAKVLASI
PDEHPLTAVVHAAGVLDDGVSESLTVERLDQVLRPKVDGARNLLELIDPDVALVLFSSVS
GVLGSGGQGNYAAANSFLDALAQQRQSRGLPTRSLAWGPWAEHGMASTLREAEQDRLARS
GLLPISTEEGLSQFDAACGGAHTVVAPVRFSRLSDGNAIKFSVLQGLVGPHRVNKAATAD
DAESLRKRLGRLPDAEQHRILLDLVRMHVAAVLGFAGSQEITADGTFKVLGFDSLTVVEL
RNRINGATGLRLPATLVFNYPTPDALAAHLVTALSADRLAGTFEELDRWAANLPTLARDE
ATRAQITTRLQAILQSLADVSGGTGGGSVPDRLRSATDDELFQLLDNDLELP
selected fasta
>polyketide synthase [polyketide synthase extender module 2]
ATGACGGTGACCACCAGTTACGAAGAAGTTGTCGAGGCACTGCGAGCATCGCTCAAGGAG
AACGAACGCCTCCGGCGCGGCAGGGATCGGTTCTCCGCGGAGAAGGACGATCCCATCGCG
ATCGTGGCGATGAGTTGTCGTTATCCCGGTCAGGTCTCCTCGCCGGAGGACCTGTGGCAA
CTGGCTGCCGGCGGTGTGGACGCGATCTCCGAAGTTCCGGGGGATCGCGGATGGGACCTG
GATGGCGTGTTCGTTCCGGACTCCGATCGTCCTGGCACGTCGTATGCCTGCGCGGGCGGT
TTTCTTCAGGGCGTGTCGGAGTTCGACGCGGGTTTCTTCGGGATTTCGCCGCGTGAGGCG
CTGGCGATGGATCCGCAGCAGCGGTTGCTGCTGGAAGTCGCGTGGGAGGTCTTCGAGCGG
GCTGGGCTGGAGCAGCGGTCGACACGCGGTTCCCGCGTTGGCGTGTTCGTCGGCACCAAT
GGCCAGGACTACGCGTCGTGGTTGCGGACGCCGCCGCCTGCGGTGGCAGGTCATGTGCTG
ACGGGCGGTGCGGCAGCGGTTCTTTCGGGCCGGGTTGCGTATTCGTTCGGGTTCGAGGGT
CCTGCGGTGACGGTGGATACGGCGTGTTCGTCGTCGTTGGTGGCGTTGCACCTGGCGGGG
CAAGCACTGCGGGCCGGTGAGTGCGACCTTGCCCTTGCCGGTGGCGTCACGGTGATGTCG
ACGCCGAAGGTGTTCCTGGAGTTCTCCCGCCAACGGGGTCTCGCGCCGGATGGGCGGTGC
AAGTCGTTCGCGGCGGGTGCGGATGGCACTGGATGGGGTGAGGGTGCCGGACTGTTGTTG
CTGGAGCGGTTGTCGGATGCCCGGCGGAATGGGCATGAGGTGCTGGCGGTTGTTCGTGGT
AGTGCGGTGAATCAGGACGGTGCGTCGAATGGTTTGACCGCGCCGAATGGTTCGTCGCAG
CAGCGGGTGATTACCCAGGCGTTGGCGAGTGCGGGGTTGTCGGTGTCCGATGTGGATGCT
GTGGAGGCGCATGGGACGGGCACGCGGCTTGGTGATCCGATCGAGGCGCAGGCGCTGATC
GCCACCTACGGCCGTGATCGTGATCCTGGCCGGCCGTTGTGGTTGGGGTCGGTCAAGTCG
AACATCGGTCATACGCAAGCGGCGGCGGGTGTGGCTGGTGTGATCAAGATGGTGATGGCG
ATGCGGCACGGGCAGCTGCCACGCACGTTGCACGTGGAATCGCCGTCGCCGGAGGTGGAT
TGGTCGGCGGGGACGGTTCAACTCCTTACGGAGAACACGCCCTGGCCCAGGAGTGGTCGT
GTTCGTCGGGTGGGGGTGTCGTCGTTCGGGATCAGTGGTACTAACGCGCACGTCATCCTC
GAACAGCCCCCGGGAGTGCCGAGTCAGTCTGCGGGGCCGGGTTCGGGTTCTGTCGTGGAT
GTTCCGGTGGTGCCGTGGATGGTGTCGGGCAAAACACCCGAAGCGCTATCCGCGCAGGCA
ACGGCGTTGATGACCTATCTGGACGAGCGACCTGATGTCTCCTCGCTGGATGTTGGGTAC
TCGCTGGCGTTGACACGGTCGGCGCTGGATGAGCGAGCGGTGGTGCTGGGGTCGGACCGT
GAAACGTTGTTGTGCGGTGTGAAAGCGCTGTCTGCCGGTCATGAGGCTTCTGGGTTGGTG
ACCGGATCTGTGGGGGCTGGGGGCCGCATCGGGTTTGTGTTTTCCGGTCAGGGTGGTCAG
TGGCTGGGGATGGGCCGGGGGCTTTACCGGGCTTTTCCGGTGTTCGCTGCTGCCTTTGAC
GAAGCTTGTGCCGAGCTGGATGCACATCTGGGCCAGGAAATCGGGGTTCGGGAGGTGGTG
TCCGGTTCGGATGCGCAGTTGCTGGATCGGACGTTGTGGGCGCAGTCGGGTTTGTTCGCG
TTGCAGGTGGGCTTGCTGAAGTTGCTGGATTCGTGGGGGGTTCGGCCGAGTGTGGTGTTG
GGGCATTCGGTGGGCGAGTTGGCGGCGGCGTTCGCGGCGGGTGTGGTGTCGTTGTCGGGT
GCGGCTCGGTTGGTGGCGGGTCGTGCCCGGTTGATGCAGGCGTTGCCGTCTGGCGGTGGG
ATGCTGGCGGTGCCTGCTGGTGAGGAGCTGTTGTGGTCGTTGTTGGCCGATCAGGGTGAT
CGTGTGGGGATCGCCGCGGTCAACGCTGCGGGGTCGGTGGTGCTCTCTGGTGATCGGGAT
GTGCTCGATGACCTTGCCGGTCGGCTGGACGGGCAAGGGATCCGGTCGAGGTGGTTGCGG
GTGTCGCATGCGTTTCATTCGTATCGGATGGATCCGATGCTGGCGGAGTTCGCCGAATTG
GCACGAACCGTGGATTACCGGCGTTGTGAAGTGCCGATCGTGTCGACCTTGACCGGAGAC
CTCGATGACGCTGGCAGGATGAGCGGGCCCGACTACTGGGTGCGTCAGGTGCGAGAGCCG
GTCCGCTTCGCCGACGGTGTCCAGGCGCTGGTCGAGCACGATGTGGCCACTGTTGTCGAG
CTCGGTCCGGACGGGGCGTTGTCGGCGCTGATCCAGGAATGTGTCGCCGCATCCGATCAC
GCCGGGCGGCTGAGCGCGGTCCCGGCGATGCGCAGGAACCAGGACGAGGCGCAGAAGGTG
ATGACGGCCCTGGCACACGTCCACGTACGTGGTGGTGCGGTGGACTGGCGGTCGTTCTTC
GCCGGTACGGGAGCGAAACAAATCGAGCTGCCCACCTACGCCTTCCAACGACAGCGGTAC
TGGCTGGTGCCATCGGATTCCGGTGATGTGACAGGTGCCGGTCTGGCCGGGGCGGAGCAT
CCGCTGTTGGGTGCTGTGGTGCCGGTCGCGGGTGGTGACGAGGTGTTGCTGACCGGCAGG
ATTTCGGTGCGGACGCATCCGTGGCTGGCCGAACACCGGGTGCTGGGTGAAGTGATCGTT
GCGGGCACCGCGTTGCTGGAGATCGCCTTGCACGCGGGGGAACGTCTTGGTTGTGAACGG
GTGGAAGAGCTCACCCTGGAAGCACCGCTGGTCCTGCCGGAGCGCGGGGCGATCCAGGTT
CAGCTGCGAGTGGGCGCGCCCGAGAATTCCGGACGCAGGCCGATGGCGCTGTATTCACGC
CCCGAAGGGGCGGCGGAGCATGACTGGACGCGGCACGCCACGGGCCGGTTGGCGCCAGGC
CGCGGCGAGGCGGCTGGAGACCTGGCCGACTGGCCGGCTCCTGGCGCGCTGCCGGTCGAC
CTCGACGAATTCTATCGGGACCTCGCAGAGCTTGGGCTGGAGTACGGCCCGATCTTCCAA
GGGCTCAAGGCGGCCTGGCGGCAAGGGGACGAGGTGTACGCCGAAGCCGCGCTGCCGGGA
ACGGAAGATTCTGGTTTCGGGGTGCATCCGGCACTGCTGGACGCGGCTCTGCACGCAACG
GCTGTCCGAGACATGGATGACGCACGCTTGCCGTTCCAGTGGGAAGGTGTGTCCCTGCAC
GCCAAGGCCGCGCCGGCTTTGCGGGTCCGCGTGGTCCCGGCTGGTGACGATGCCAAGTCC
CTGCTGGTTTGTGATGGCACCGGTCGACCGGTGATCTCGGTGGACCGACTCGTATTGCGG
TCGGCTGCGGCCCGGCGGACCGGTGCGCGCCGACAGGCCCATCAAGCTCGGTTGTACCGG
TTGAGCTGGCCAACGGTTCAACTGCCGACATCCGCTCAGCCACCGTCCTGCGTGCTTCTC
GGCACCTCAGAAGTGTCCGCTGACATACAGGTGTATCCGGACCTCCGGTCGTTGACGGCT
GCGTTGGATGCCGGTGCCGAACCACCCGGCGTCGTCATCGCACCCACGCCCCCCGGCGGT
GGACGAACAGCGGATGTCCGGGAGACGACTCGGCATGCACTCGACCTGGTACAAGGCTGG
CTTTCCGATCAGCGACTCAACGAATCCCGATTGCTCCTGGTGACACAGGGAGCAGTGGCC
GTGGAGCCGGGCGAACCCGTGACCGATCTGGCGCAGGCCGCGCTCTGGGGACTGCTGCGG
TCGACGCAGACCGAACACCCTGATCGCTTCGTCCTCGTCGATGTGCCTGAGCCCGCGCAA
CTCCTCCCCGCGCTGCCGGGGGTGCTGGCCTGCGGCGAACCTCAGCTCGCGTTGCGACGT
GGCGGCGCTCATGCGCCCAGACTGGCTGGACTGGGCAGCGATGACGTCCTGCCCGTGCCG
GACGGCACCGGGTGGCGATTGGAGGCCACGCGCCCGGGAAGCCTGGATGGGTTGGCATTG
GTGGACGAACCGACGGCCACGGCACCGCTGGGTGACGGTGAGGTCAGGATTGCGATGCGC
GCGGCCGGGGTGAACTTCCGGGATGCGCTCATCGCGCTCGGTATGTATCCCGGTGTGGCA
TCGCTGGGCAGTGAGGGCGCCGGGGTCGTGGTGGAGACCGGCCCCGGCGTCACCGGCCTG
GCACCCGGCGACCGCGTGATGGGAATGATCCCGAAGGCGTTCGGGCCGCTCGCGGTCGCC
GACCATCGCATGGTGACGAGGATTCCCGCTGGTTGGAGCTTCGCGCGGGCCGCATCGGTG
CCGATCGTCTTTCTCACCGCCTACTACGCGCTGGTTGATCTCGCCGGGTTGAGACCAGGG
GAGTCGTTGCTGGTTCATTCGGCCGCCGGTGGGGTGGGGATGGCCGCGATCCAACTCGCC
AGGCACCTCGGTGCAGAGGTGTACGCCACCGCTAGCGAGGACAAGTGGCAAGCCGTGGAG
CTGAGCCGAGAACACCTCGCTTCGTCGCGGACGTGCGATTTCGAGCAGCAGTTCCTCGGG
GCAACCGGCGGACGCGGCGTCGACGTCGTGCTCAACTCCCTCGCCGGGGAGTTCGCCGAT
GCGTCTCTGCGAATGCTGCCGCGCGGTGGCCGTTTCCTGGAGTTGGGGAAGACGGATGTT
CGTGACCCCGTCGAGGTCGCCGATGCGCATCCGGGCGTGTCTTACCAGGCTTTCGATACC
GTAGAGGCAGGCCCGCAGCGAATCGGCGAGATGCTTCACGAGCTGGTGGAGTTGTTCGAG
GGACGCGTGCTGGAGCCCCTGCCTGTCACGGCTTGGGACGTTCGGCAGGCGCCCGAGGCG
CTACGGCACCTGAGCCAAGCGCGGCATGTGGGAAAGCTGGTGCTCACCATGCCTCCGGTG
TGGGACGCCGCAGGCACGGTTCTGGTTACCGGCGGAACGGGAGCACTTGGCGCAGAGGTC
GCCCGGCACCTCGTGATCGAGCGCGGGGTGCGAAACCTGGTCCTCGTCAGCAGGCGCGGT
CCCGCAGCCAGTGGCGCTGCTGAGCTCGTGGCGCAACTGACGGCCTACGGTGCCGAGGTT
TCCTTGCAGGCTTGCGATGTCGCCGATCGTGAGACCTTGGCGAAGGTGCTTGCCAGCATC
CCGGACGAGCATCCGTTGACCGCCGTGGTGCACGCGGCTGGTGTTCTCGACGACGGAGTG
TCCGAATCGCTCACCGTGGAGCGGCTGGACCAGGTTCTGCGCCCGAAGGTCGATGGCGCG
CGGAATCTGCTCGAGCTGATCGACCCGGACGTGGCCCTCGTGTTGTTCTCGTCGGTGTCG
GGTGTGCTCGGCAGCGGTGGGCAGGGTAACTACGCGGCGGCCAACTCCTTCCTCGACGCA
TTGGCGCAGCAAAGGCAGTCGCGCGGCCTACCGACGAGATCATTGGCCTGGGGGCCCTGG
GCGGAACATGGCATGGCCAGCACCTTGCGCGAAGCCGAGCAGGATCGATTGGCGCGATCT
GGGTTGCTGCCGATCTCGACCGAGGAGGGGTTGTCCCAGTTCGACGCCGCGTGCGGCGGC
GCGCATACCGTGGTGGCGCCGGTTCGATTCAGCCGCTTGTCCGACGGGAACGCGATCAAG
TTCTCCGTCCTGCAAGGTTTGGTCGGGCCGCATCGCGTCAACAAAGCGGCGACTGCGGAT
GATGCCGAGAGCCTCCGGAAACGGTTGGGACGCTTGCCGGATGCAGAACAACATCGGATT
CTGCTGGACCTCGTCCGCATGCATGTGGCGGCAGTGCTCGGATTCGCCGGTTCTCAGGAG
ATCACCGCGGACGGCACGTTCAAGGTGCTGGGCTTCGACTCGTTGACCGTGGTCGAGTTG
CGCAACCGGATCAACGGGGCGACGGGGCTGCGACTGCCCGCCACCCTGGTGTTCAACTAC
CCGACGCCGGATGCGCTCGCCGCGCACCTCGTCACCGCGCTGTCCGCAGACCGCCTGGCC
GGGACATTCGAGGAACTCGACAGGTGGGCGGCGAACCTGCCCACGCTGGCCAGGGATGAG
GCCACGCGGGCGCAGATCACCACCCGGCTACAGGCGATCTTGCAGAGCCTGGCGGACGTG
TCCGGCGGAACCGGCGGCGGCTCCGTGCCGGACCGGCTCAGATCGGCCACGGACGACGAG
CTTTTCCAACTCCTCGACAACGATCTCGAACTTCCCTGA
[2] KS37..413
[2] AT572..893
[2] malonyl-CoA763..767
[2] DH940..1102
[2] ER1413..1715
[2] KR1725..1903
[2] ACP2001..2071
[2] KS109..1239
[2] AT1714..2679
[2] malonyl-CoA2287..2301
[2] DH2818..3306
[2] ER4237..5145
[2] KR5173..5709
[2] ACP6001..6213

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [567-695]  1.79999999999997e-73 G3DSA:3.40.366.10 [763-883]  1.79999999999997e-73 G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002364 Quinone oxidoreductase/zeta-crystallin, conserved site (Conserved_site)
 [1540-1561]  PS01162
PS01162   QOR_ZETA_CRYSTAL
IPR009081 Acyl carrier protein-like (Domain)
 [2001-2071]  PS50075
PS50075   ACP_DOMAIN
 [2005-2070]  6.1e-13 PF00550
PF00550   PP-binding
 [2001-2074]  1.5e-20 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1993-2077]  2.49999811956465e-21 SSF47336
SSF47336   ACP_like
IPR011032 GroES-like (Domain)
 [1407-1558]  3.59998852907783e-33 SSF50129
SSF50129   GroES_like
IPR013149 Alcohol dehydrogenase, C-terminal (Domain)
 [1551-1643]  7e-16 PF00107
PF00107   ADH_zinc_N
IPR013154 Alcohol dehydrogenase GroES-like (Domain)
 [1433-1488]  6.4e-08 PF08240
PF08240   ADH_N
IPR013968 Polyketide synthase, KR (Domain)
 [1725-1902]  1.80000000000002e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [37-287]  9.49999999999983e-93 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [295-413]  8.70000000000003e-49 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [572-893]  2.09999999999996e-65 PF00698
PF00698   Acyl_transf_1
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [569-860]  6.90004508941104e-67 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [697-762]  1e-16 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [36-298]  1.20000000000001e-87 G3DSA:3.40.47.10 [299-464]  1.10000000000001e-66 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [29-411]  1.39999277195148e-103 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1548-1649]  5.80000000000004e-20 G3DSA:3.40.50.720 [1726-1909]  7.00000000000005e-38 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [200-216]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [573-874]  8.70005082121738e-117 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [2002-2074]  2.70000183580794e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [940-1102]  5.39997012872478e-85 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [39-465]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1725-1903]  2.60000517657733e-62 SM00822
SM00822   PKS_KR
IPR020843 Polyketide synthase, enoylreductase (Domain)
 [1413-1715]  SM00829
SM00829   PKS_ER
SignalP No significant hit
TMHMM No significant hit