close all open/close all

CDS information : Spino_00190


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction35,419 / 44,931 / + [in whole cluster]
35,419 / 44,931 / + [in contig]
Location35419..44931 [in whole cluster]
35419..44931 [in contig]
TypeCDS
Length9,513 bp (3,170 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase extender modules 3-4
Gene
Gene (GenBank)spnC
EC number
Keyword
Note
Note (GenBank)
  • probably involved in spinosyn aglycone biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
[14685317] Heterologous expression in Saccharopolyspora erythraea of a pentaketide synthase derived from the spinosyn polyketide synthase. (Org Biomol Chem. , 2003)
[26976746] Alteration of Polyketide Stereochemistry from anti to syn by a Ketoreductase Domain Exchange in a Type I Modular Polyketide Synthase Subunit. (Biochemistry. , 2016)

close this sectionPKS/NRPS Module

3 methylmalonyl-CoA
4 malonyl-CoA
KS34..410
AT563..881
KR1194..1369
ACP1470..1540
KS1561..1937
AT2099..2420
KR2735..2914
ACP3017..3087

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase extender modules 3-4]
MSNEEKLREYLRRALVDLHQARERLHEAESGEREPIAIVAMGCRYPGGVQDPEGLWKLVA
SGGDAIGEFPADRGWHLDELYDPDPDQPGTCYTRHGGFLHDAGEFDAGFFDISPREALAM
DPQQRLLLEISWETVESAGMDPRSLRGSRTGVFAGLMYEGYDTGAHRAGEGVEGYLGTGN
AGSVASGRVAYAFGFEGPAVTVDTACSSSLVALHLACQSLRQGECDLALAGGVTVMSTPE
RFVEFSRQRGLAPDGRCKSFAAAADGTGWGEGAGLVLLERLSDARRNGHRVLAVVRGSAV
NQDGASNGLTAPNGLAQERVIQQVLTSAGLSASDVDAVEAHGTGTRLGDPIEAQALIAAY
GQDRDRDRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRHGELPRTLHVDEPNSHVDWSA
GAVRLLTENIRWPGTGTRRAGVSSFGVSGTNAHVILEHDPLAVTENEEAAQSPAPGIVPW
ALSGRSSTALRAQAERLRELCEQTDPDPVDVGFSLAATRTAWEHRAVVLGRDSATLRSGL
GVVASGEPAVDVVEGSVLDGEVVFVFPGQGWQWAGMAVDLLDASPTFARHMDECATALRR
YVDWSLVDVLRGAENSPPLDRVDVLQPASFAVMVSLAEVWRSYGVRPAAVVGHSQGEIAA
ACAAGVLPLEDAARLVALRSRALKGLSGRGGMASLACPADEVAALFAGSGGRLEVAAING
PRSVVVSGDLEAVDELLAECAEKDMRARRIPVDYASHSAHVEVVRSPVLAAAAGVRHRDG
QVPWWSTVIGDWVDPARLDGEYWYRNLRQPVRFEHAVQGLVERGFGLFIEMSAHPVLTTA
VEETGAESETAVAAVGTLRRDSGGLRRLLHSLAEAYVRGATVDWAVAFGGAGRRLDLPTY
PFQRQRYWLDKGAASDEARAVSDPAAGWFWQAVARQDLKSVSDALDLDADAPLSATLPAL
SVWHRQERERVLADGWRYRVDWVRVAPQPVRRTRETWLLVVPPGGIEEALVERLTDALNT
RGISTLRLDVPPAATSGELATELRAAADGDPVKAILSLTALDERPHPECKDVPSGIALLL
NLVKALGEADLRIPLWTITRGAVKAGPADRLLRPMQAQAWGLGRVAALEHPERWGGLIDL
PDSLDGDVLTRLGEALTNGLAEDQLAIRQSGVLARRLVPAPANQPAGRKWRPRGSALITG
GLGAVGAQVARWLAEIGAERIVLTSRRGNQAAGAAELEAELRALGAQVSIVACDVTDRAE
MSALLAEFDVTAVFHAAGVGRLLPLAETDQNGLAEICAAKVRGAQVLDELCDSTDLDAFV
LFSSGAGVWGGGGQGAYGAANAFLDTLAEQRRARGLPATSISWGSWAGGGMADGAAGEHL
RRRGIRPMPAASAILALQEVLDQDETCVSIADVDWDRFVPTFAATRATRLFDEVPAARKA
MPANGPAEPGGSPFARNLAELPEAQRRHELVDLVCAQVATVLGHGSREEVQPERAFRALG
FDSLMAVDLRNRLTTATGLRLPTTTVFDYPNPAALAAHLLEELVGDVASAAVTAASAPAS
DEPIAIVAMSCRFPGGAHSPEDLWRLVAAGTEVIGEFPSDRGWDAEGLYDPDASRPGTTY
ARMAGFLYDAGEFDADLFGISPREALAMDPQQRLVLEIAWEALERAGIDPLSLKGSGVGT
YIGAGSRGYATDVRQFPEEAEGYLLTGTSASVLSGRVAYSFGFEGPAVTVDTACSSSLVA
LHLACQSLRSGECDLALAGGVTVMSTPEMFVEFSRQRGLAPDGRCKSFAESADGTGWGEG
AGLLLLERLSDAHRNGHRVLAVVRGSAVNQDGASNGLAAPNGPSQQRVINQALANAALSA
SDVDAVEAHGTGTRLGDPIEAQALIATYGQARERDRPLWLGSVKSNIGHTQAAAGVAGVI
KMVMAMRHGQLPASLHADEPTSEVDWSSGAVRLLAEQVPWPESDRVRRVGVSSFGISGTN
AHVILEQATNAPDSTAETDKTESGSTVDIPVVPWLVSGKTTDSLRGQAERVLSQVESRPE
QRSLDVAYSLASGRAALDERAVVLGADRGELVAGLAALAAGQEASGVISGTRASARFGFV
FSGQGGQWLGMGRALYSKFPVFAAAFDEACAELEAHLGEDRRVRDVVFGSDAQLLDQTLW
AQSGLFALQAGLLGLLGSWGVRPDVVMGHSVGELAAAFAAGVLSLRDAARLVAARARLMQ
ALPSDGAMLAVAAGEDLVRPLLAGREESVSVAALNAPGSVVLSGDREVLASIVGRLTELR
VRTRRLRVSHAFHSHRMDPMLGEFAQIAESAEFGKPTTPLVSTLTGELDRAAEMSTPGYW
VRQAREPVRFADGVQALAAQGIGTVVELGPDGTLAALVRECATESDRVGRISSIPLMRRE
RDETRSVMTALAHLHTRGGEVDWQAFFAGTGARQLELPTYAFQRQHYWIESSARPARDRA
DIGEVAEQFWTAVDQGDLATLVAALDLGADDDTCASLSDVLPALSSWRSGLRNRSLVDSC
RYRISWHSSREVPAPKISGTWLLVVPGAADDGLVTALTSSLVGGGAEVVRIGLSEEDPHR
EDVAQRLANALTDAGQLGGVLSLLGLDESPAPGFSCLPTGFALTVQLLRALRKADVEAPF
WAVTRGGVALEDVRVSPEQALVWGLLRVAGLEHPEFWGGLIDLPSDWDDRLGARLAGVLA
DGGEDQVAIRRGGVFVRRLERAGASGAGSVWRPRGTVLVTGGTGGLGAHVARWLAGAGAE
HVVLTSRRGADAPGAGELRAELEALGARVSIVPCDVADRDAVAGVLAGIGGECPLTAVVH
AAGVGEAGDVVEMGLADFAAVLSAKVRGAANLDELLADSELDAFVMFSSVSGVWGAGGQG
AYAAANAYLDALAEQRRARGLVGTAVAWGPWAGDGMAAGETGAQLHRMGLASMEPSAALL
ALQGALDRDETSLVVADVDWARFAPAFTSARRRPLLDTIDEARAALETTGEQAGTGKPVE
LTQRLAGLSRKERDDAVLDLVRAETAAVLGRDDATALAPSRPFQELGFDSLMAVELRNRL
NTATGIQLPASTIFDYPNAESLSRHLCAELFPTETTVDSALAELDRIEQQLSMLTGEARA
RDRIATRLRALHEKWNSAAEVPTGADVLSTLDSATHDEIFEFIDNELDLS
selected fasta
>polyketide synthase [polyketide synthase extender modules 3-4]
ATGTCGAATGAAGAGAAGCTCCGGGAGTACTTGCGGCGTGCGCTCGTGGATCTGCACCAG
GCGCGCGAGCGGCTGCACGAGGCGGAGTCGGGAGAGCGGGAACCCATCGCGATCGTGGCG
ATGGGCTGCCGGTACCCGGGTGGGGTGCAGGACCCGGAAGGGCTGTGGAAACTGGTCGCC
TCCGGTGGCGACGCCATCGGTGAATTCCCCGCTGATCGTGGTTGGCACCTCGACGAGCTC
TACGATCCCGACCCGGATCAGCCCGGAACCTGCTACACCCGGCACGGCGGCTTCCTCCAC
GACGCCGGCGAGTTCGACGCGGGATTCTTCGACATCAGCCCCCGTGAGGCGCTCGCGATG
GACCCGCAGCAGCGGCTGCTGCTGGAAATCTCCTGGGAGACCGTCGAATCCGCTGGGATG
GACCCGAGGTCCTTGCGGGGGAGCCGCACCGGGGTGTTCGCGGGATTGATGTACGAGGGC
TATGACACCGGCGCCCACCGGGCAGGAGAAGGTGTCGAAGGCTATCTCGGAACCGGCAAT
GCGGGAAGCGTCGCCTCTGGTCGGGTTGCGTATGCGTTCGGGTTCGAGGGCCCAGCGGTG
ACGGTAGACACGGCGTGCTCGTCGTCGTTGGTGGCGCTGCATTTGGCGTGTCAGTCGTTG
CGGCAGGGCGAGTGTGATCTGGCGCTGGCCGGTGGAGTGACGGTGATGTCGACGCCGGAG
AGGTTCGTGGAGTTCTCCCGTCAGCGTGGTCTCGCACCGGATGGGCGGTGTAAGTCGTTC
GCGGCGGCTGCGGATGGAACCGGTTGGGGTGAGGGTGCCGGTTTGGTGTTGCTGGAGCGG
CTGTCAGACGCCAGGCGGAACGGGCATCGGGTACTGGCGGTTGTTCGTGGTAGCGCGGTG
AATCAGGACGGTGCGTCGAACGGATTGACGGCCCCGAACGGGCTGGCCCAGGAGCGGGTC
ATTCAGCAGGTGCTCACGAGTGCGGGGCTGTCGGCGTCCGATGTGGACGCTGTGGAGGCG
CATGGAACGGGTACGCGGCTTGGTGATCCGATCGAGGCGCAGGCTCTGATAGCCGCCTAT
GGACAGGATCGGGACCGGGACCGGCCGCTGTGGTTGGGGTCGGTCAAGTCCAACATCGGT
CATACGCAGGCGGCTGCGGGCGTCGCTGGTGTGATCAAGATGGTCATGGCGATGCGGCAC
GGGGAGCTGCCGCGCACGTTGCACGTGGACGAGCCGAATTCGCACGTGGACTGGTCGGCT
GGTGCGGTCCGACTCCTGACCGAGAACATCCGCTGGCCAGGGACGGGTACGCGCCGCGCT
GGAGTGTCGTCGTTCGGGGTAAGCGGTACCAACGCACACGTCATCCTCGAACACGACCCG
CTCGCCGTGACCGAGAACGAGGAAGCAGCGCAGTCCCCAGCACCTGGGATCGTGCCCTGG
GCGTTGTCCGGGCGGTCGTCGACGGCGCTGCGGGCCCAGGCCGAACGGCTGCGCGAGCTG
TGCGAGCAGACCGATCCCGACCCCGTCGATGTCGGTTTCTCACTGGCCGCCACGCGCACG
GCTTGGGAGCACCGAGCGGTGGTGCTTGGTCGGGACAGCGCTACGTTGCGCTCCGGGCTT
GGCGTTGTTGCCAGCGGTGAACCAGCGGTCGATGTCGTTGAGGGGAGCGTCCTGGACGGC
GAGGTCGTCTTCGTCTTCCCCGGTCAGGGCTGGCAGTGGGCCGGTATGGCAGTCGACCTG
CTGGACGCTTCGCCGACGTTCGCGCGCCACATGGACGAGTGCGCCACCGCGCTGCGGAGG
TACGTGGACTGGTCGTTGGTCGACGTGCTGCGCGGAGCGGAGAACTCCCCACCGCTGGAC
CGGGTGGACGTGCTCCAGCCCGCGTCCTTCGCGGTGATGGTGTCGCTCGCCGAGGTGTGG
CGTTCCTACGGGGTGAGGCCGGCGGCCGTCGTCGGCCACAGTCAAGGCGAAATCGCCGCG
GCCTGCGCAGCCGGGGTGCTGCCGCTGGAGGATGCGGCCAGGCTTGTCGCATTGCGCAGC
AGAGCGTTGAAGGGACTTTCGGGGCGGGGTGGCATGGCGTCGCTGGCCTGCCCTGCGGAT
GAGGTCGCGGCATTGTTCGCGGGATCGGGCGGCCGTCTGGAAGTTGCGGCGATCAACGGC
CCGCGATCGGTCGTGGTGTCCGGCGATCTGGAAGCGGTGGACGAACTGCTGGCAGAGTGC
GCTGAAAAGGACATGCGTGCACGCCGTATCCCCGTCGACTACGCCTCGCATTCAGCGCAC
GTGGAGGTGGTTCGGAGCCCGGTGCTGGCGGCCGCCGCCGGGGTGCGACACCGGGACGGC
CAGGTGCCGTGGTGGTCGACGGTGATCGGCGACTGGGTGGATCCGGCCAGGCTGGACGGC
GAGTATTGGTATCGGAACCTCCGGCAGCCGGTCCGGTTCGAACACGCCGTGCAGGGCCTG
GTCGAGCGGGGATTCGGCCTGTTCATCGAAATGAGTGCGCATCCGGTGCTGACCACGGCG
GTCGAGGAAACCGGTGCGGAGTCGGAGACCGCCGTGGCCGCGGTAGGTACCTTGCGACGT
GACTCGGGCGGCCTCCGGAGGTTGTTGCATTCGCTGGCCGAGGCGTACGTGCGCGGCGCC
ACCGTGGACTGGGCCGTGGCGTTCGGGGGCGCGGGCCGACGGCTGGACCTGCCGACCTAC
CCGTTCCAGCGCCAGCGGTACTGGCTGGACAAGGGAGCTGCCTCCGACGAGGCTCGTGCG
GTCTCGGACCCGGCGGCGGGCTGGTTCTGGCAAGCCGTGGCGCGCCAAGACCTGAAAAGC
GTGTCCGATGCCCTCGATCTCGACGCCGACGCACCGCTGAGCGCAACACTTCCAGCCCTG
TCCGTCTGGCACCGTCAGGAACGAGAAAGGGTCTTGGCAGACGGTTGGCGGTACCGAGTC
GACTGGGTACGGGTGGCCCCGCAGCCGGTCCGGAGAACGCGGGAAACCTGGCTCCTGGTC
GTTCCCCCGGGCGGCATCGAGGAAGCGCTGGTCGAACGGCTGACGGATGCGTTGAACACG
CGAGGGATCAGCACCCTGCGCCTCGACGTGCCACCGGCGGCGACCAGTGGCGAACTCGCA
ACCGAACTCCGCGCCGCAGCCGACGGTGACCCGGTGAAGGCAATCCTGTCGCTCACCGCG
TTGGACGAGCGACCCCACCCCGAATGCAAGGACGTCCCGAGCGGGATTGCCTTGCTGCTG
AACCTGGTCAAGGCGCTCGGTGAAGCCGACCTCAGAATTCCTCTGTGGACCATCACGCGT
GGTGCGGTCAAGGCAGGCCCCGCAGATCGGCTGCTGCGCCCGATGCAGGCGCAAGCATGG
GGTCTGGGGCGAGTAGCCGCACTCGAACACCCCGAGCGCTGGGGTGGGCTGATCGACCTG
CCGGATTCGCTGGACGGCGACGTCCTCACGAGGCTGGGCGAAGCGCTCACCAACGGCTTG
GCGGAAGACCAACTGGCGATTCGCCAGTCGGGCGTGCTGGCCCGGCGACTGGTACCCGCC
CCGGCGAATCAGCCCGCTGGACGTAAGTGGCGCCCCCGAGGGAGCGCGCTGATCACGGGC
GGACTCGGCGCGGTGGGCGCACAGGTGGCGAGGTGGTTGGCCGAAATCGGAGCCGAGCGA
ATCGTGCTCACCAGTCGACGGGGCAACCAAGCAGCAGGCGCCGCCGAGCTGGAAGCCGAA
CTCCGGGCCCTTGGAGCGCAAGTGTCCATCGTGGCTTGCGACGTGACCGATCGTGCCGAG
ATGTCCGCACTACTGGCCGAGTTCGACGTCACCGCGGTGTTCCACGCGGCCGGAGTCGGT
CGGCTGCTGCCGTTGGCGGAGACCGACCAGAACGGCCTGGCCGAAATATGCGCGGCGAAG
GTCCGCGGCGCTCAGGTGCTGGACGAACTGTGCGACAGCACCGATCTCGATGCCTTCGTC
CTGTTCTCCTCGGGTGCCGGGGTATGGGGCGGGGGCGGTCAGGGCGCTTACGGCGCGGCG
AACGCATTCTTGGACACACTCGCCGAACAACGCCGAGCACGCGGTCTGCCGGCAACCTCG
ATCTCCTGGGGCAGTTGGGCCGGCGGCGGCATGGCCGACGGCGCGGCGGGCGAACACCTG
CGGCGACGCGGGATACGTCCGATGCCGGCGGCGTCGGCCATCCTGGCTCTGCAGGAAGTA
CTTGACCAGGATGAGACGTGCGTGTCGATCGCTGATGTGGACTGGGACCGATTCGTTCCC
ACGTTCGCCGCGACTCGCGCCACCCGGTTGTTCGACGAAGTGCCGGCGGCGAGAAAGGCG
ATGCCCGCGAATGGGCCGGCAGAACCAGGCGGCTCGCCGTTCGCCCGCAATCTCGCGGAG
CTGCCGGAAGCCCAACGACGCCACGAACTGGTGGATCTGGTGTGCGCCCAGGTGGCAACC
GTGCTCGGGCACGGCAGTCGCGAGGAAGTCCAGCCCGAGCGGGCGTTCCGCGCGCTCGGG
TTCGACTCCCTCATGGCGGTGGATCTGCGCAATCGTTTGACCACCGCCACCGGGTTGCGC
CTGCCGACCACAACCGTCTTCGACTACCCGAATCCGGCCGCCTTGGCCGCTCACCTGCTC
GAGGAGCTGGTGGGTGATGTCGCGTCGGCTGCGGTGACCGCTGCCAGCGCGCCCGCGAGT
GACGAACCGATCGCGATCGTCGCGATGAGCTGCCGGTTTCCGGGTGGCGCGCACTCGCCG
GAAGACCTGTGGCGGCTGGTCGCCGCCGGCACGGAGGTGATCGGCGAGTTCCCCTCCGAC
CGGGGCTGGGATGCGGAAGGCCTTTACGATCCGGATGCTTCCAGGCCTGGAACGACGTAT
GCGCGGATGGCGGGATTCCTCTACGACGCCGGTGAGTTCGATGCCGACCTGTTCGGCATC
AGCCCACGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGTTGGTGCTCGAAATCGCCTGG
GAAGCCCTCGAACGGGCCGGAATCGATCCGTTGTCCTTGAAGGGCAGTGGGGTCGGCACG
TACATCGGCGCTGGAAGCCGTGGGTACGCGACGGATGTGCGGCAGTTTCCCGAGGAGGCG
GAGGGCTACCTGCTGACGGGTACCTCGGCCAGTGTGCTGTCGGGTCGGGTCGCGTATTCG
TTTGGTTTCGAGGGTCCTGCGGTGACGGTGGATACGGCTTGTTCGTCGTCGTTGGTGGCG
TTGCATCTGGCGTGCCAGTCGTTGCGTTCGGGCGAGTGTGATCTGGCGTTGGCCGGTGGT
GTGACCGTGATGTCGACGCCGGAGATGTTCGTGGAGTTCTCCCGTCAGCGCGGTTTGGCG
CCGGATGGGCGGTGCAAGTCGTTCGCGGAGAGCGCGGACGGCACCGGCTGGGGCGAAGGC
GCGGGCCTGTTGTTGCTGGAGCGGTTGTCGGACGCCCACCGGAATGGGCATCGGGTGTTG
GCGGTGGTTCGTGGGTCAGCGGTGAATCAGGACGGCGCCTCGAACGGACTGGCGGCGCCG
AACGGTCCGTCGCAGCAGCGGGTGATCAACCAGGCACTCGCGAATGCGGCTCTTTCGGCG
TCCGATGTGGATGCGGTGGAGGCACATGGCACCGGGACCAGGCTGGGTGATCCGATCGAG
GCGCAGGCATTGATCGCAACGTATGGGCAGGCCCGGGAGCGGGATCGGCCCTTGTGGCTG
GGGTCGGTCAAGTCGAACATCGGTCATACGCAGGCCGCGGCGGGTGTTGCCGGTGTGATC
AAGATGGTGATGGCCATGCGGCACGGGCAGCTGCCCGCCTCGCTGCACGCGGATGAGCCC
ACGTCGGAGGTCGATTGGTCGTCGGGGGCGGTCCGGCTCCTCGCCGAACAGGTACCTTGG
CCGGAGTCTGACCGTGTTCGTCGGGTGGGGGTTTCGTCGTTCGGGATCAGCGGCACCAAC
GCACATGTGATCCTCGAACAAGCTACGAATGCGCCAGATAGTACAGCGGAGACGGACAAA
ACAGAATCCGGATCTACTGTCGATATTCCGGTCGTTCCCTGGTTGGTGTCGGGAAAGACG
ACGGATTCCCTGCGGGGACAAGCCGAACGAGTCTTGTCTCAGGTCGAGTCCCGGCCGGAG
CAGCGTTCGCTGGATGTTGCCTACTCGCTTGCTTCTGGCCGAGCCGCGCTGGATGAACGC
GCTGTCGTGCTGGGTGCGGACCGCGGTGAGCTGGTTGCTGGACTGGCGGCGTTGGCCGCC
GGTCAGGAGGCTTCTGGGGTGATCAGCGGAACTCGTGCTTCTGCTCGGTTCGGGTTCGTG
TTCTCGGGGCAGGGTGGTCAGTGGTTGGGGATGGGCAGAGCGCTCTACTCGAAGTTTCCG
GTGTTCGCTGCTGCGTTTGATGAGGCTTGCGCCGAGTTGGAGGCACATCTGGGGGAAGAC
CGCCGGGTTCGGGATGTGGTCTTCGGTTCCGATGCGCAGCTGCTGGATCAGACGCTGTGG
GCGCAGTCGGGTCTGTTCGCGCTGCAAGCCGGCCTCTTGGGGCTGCTGGGTTCGTGGGGC
GTTCGGCCGGATGTGGTGATGGGGCATTCGGTCGGGGAGTTGGCCGCCGCGTTTGCGGCT
GGCGTGTTGTCGTTGCGGGATGCGGCTCGGTTGGTGGCCGCGCGCGCCCGGTTGATGCAA
GCCCTGCCCTCTGACGGCGCGATGTTGGCGGTGGCTGCTGGTGAAGACCTTGTTCGGCCA
TTGCTGGCCGGTCGGGAGGAGTCCGTGAGCGTCGCCGCGCTCAATGCCCCCGGTTCGGTG
GTGTTGTCGGGCGATCGGGAGGTGCTGGCCAGCATCGTCGGCCGGCTGACCGAGCTCCGA
GTCCGGACGCGGCGCTTGCGGGTCTCCCATGCTTTTCATTCGCACCGGATGGACCCGATG
TTGGGCGAGTTCGCCCAGATCGCCGAGTCTGCGGAGTTCGGTAAGCCAACGACACCGCTT
GTGTCGACGTTGACGGGTGAGCTCGACAGAGCCGCGGAAATGAGCACACCAGGGTATTGG
GTGCGCCAGGCGCGTGAACCCGTCCGTTTCGCCGACGGTGTCCAGGCCCTGGCAGCGCAG
GGCATAGGCACGGTCGTCGAGCTCGGCCCGGACGGAACGCTGGCGGCACTGGTTCGGGAG
TGTGCGACCGAGTCCGATCGGGTTGGGCGGATTTCGTCGATCCCACTGATGCGCAGGGAG
CGGGACGAGACCCGTTCGGTGATGACAGCCCTGGCGCATCTCCACACCCGTGGTGGTGAG
GTGGACTGGCAGGCGTTTTTCGCCGGTACCGGCGCTAGGCAGCTCGAGTTGCCAACGTAT
GCCTTCCAACGACAGCACTACTGGATCGAGTCCAGTGCGCGGCCAGCACGCGACCGCGCA
GACATCGGCGAGGTGGCGGAACAGTTCTGGACCGCGGTTGACCAAGGCGATCTGGCAACG
TTGGTCGCCGCTCTGGATCTTGGGGCGGACGACGACACATGCGCATCGTTGAGCGATGTA
TTGCCGGCGTTGTCCTCCTGGCGAAGCGGACTCCGCAACCGTTCGCTCGTCGATTCCTGC
CGGTACCGAATCAGTTGGCATTCCTCTCGGGAGGTGCCGGCCCCGAAGATTTCCGGTACC
TGGCTGTTGGTCGTGCCCGGTGCTGCGGATGACGGATTGGTCACGGCTTTGACGAGTTCA
CTGGTCGGAGGCGGCGCCGAGGTCGTCCGGATCGGCCTGTCCGAAGAGGACCCGCACCGC
GAGGACGTCGCACAGCGGCTGGCCAATGCGCTGACGGATGCCGGTCAACTCGGTGGCGTG
CTTTCGCTGTTGGGGCTCGATGAATCGCCTGCTCCGGGATTCTCCTGCTTGCCAACTGGT
TTCGCGCTGACTGTGCAGCTTCTGCGGGCCTTGCGGAAGGCCGACGTCGAGGCGCCTTTT
TGGGCGGTGACGCGCGGCGGCGTCGCGTTGGAAGATGTACGCGTGTCTCCGGAGCAGGCC
CTGGTCTGGGGGCTGCTGCGTGTCGCGGGACTGGAGCACCCGGAGTTCTGGGGTGGCTTG
ATCGACCTGCCATCGGACTGGGACGACCGATTGGGTGCCCGGTTGGCGGGTGTGTTGGCG
GATGGTGGCGAGGATCAAGTCGCCATTCGCCGTGGTGGTGTGTTCGTGCGGCGGTTGGAA
CGCGCTGGTGCGTCGGGTGCCGGGTCGGTGTGGCGTCCTCGGGGGACGGTGTTGGTGACG
GGTGGTACGGGCGGTTTGGGGGCGCATGTTGCCCGGTGGTTGGCCGGTGCCGGGGCTGAG
CACGTGGTGTTGACCAGCCGTCGAGGAGCGGACGCTCCGGGCGCTGGGGAATTGCGGGCG
GAGCTGGAGGCGCTGGGTGCTCGGGTGTCGATTGTGCCCTGCGACGTGGCTGATCGTGAC
GCAGTGGCTGGAGTGTTGGCAGGGATCGGTGGGGAGTGTCCGCTGACTGCGGTGGTACAC
GCCGCCGGGGTCGGCGAGGCGGGCGACGTAGTGGAGATGGGTTTGGCGGATTTTGCAGCG
GTGTTGTCGGCGAAGGTGCGTGGTGCGGCGAATCTGGACGAGTTGCTGGCCGACTCGGAG
CTGGATGCGTTTGTGATGTTCTCCTCGGTGTCGGGGGTGTGGGGAGCCGGCGGACAGGGT
GCGTATGCGGCTGCGAACGCCTACTTGGATGCGTTGGCCGAGCAGCGTCGGGCGAGGGGA
TTGGTCGGGACCGCGGTTGCGTGGGGACCGTGGGCCGGTGACGGCATGGCCGCCGGCGAA
ACCGGCGCACAGCTGCACCGGATGGGCCTGGCGTCGATGGAACCGAGCGCGGCGCTGCTG
GCACTTCAGGGTGCATTGGACCGCGATGAGACCTCCCTCGTCGTGGCCGATGTCGATTGG
GCACGGTTCGCCCCAGCCTTCACCTCGGCACGTCGACGCCCGCTGCTGGACACCATCGAC
GAGGCCCGAGCCGCATTGGAAACCACCGGCGAACAAGCGGGCACAGGCAAACCCGTTGAG
CTGACGCAACGCCTGGCCGGACTGTCGCGGAAGGAACGCGACGATGCGGTATTGGATCTG
GTGCGGGCGGAGACGGCGGCTGTGCTGGGACGCGACGATGCCACGGCCCTGGCGCCATCG
CGGCCGTTCCAGGAACTCGGATTCGACTCCTTGATGGCGGTGGAGCTGCGCAACCGGCTG
AACACCGCCACCGGGATCCAGCTGCCCGCCAGCACGATTTTCGACTACCCCAATGCCGAG
TCGCTGTCGCGTCACCTCTGCGCCGAGCTTTTCCCAACGGAGACTACCGTGGACTCGGCC
CTTGCCGAGCTCGATCGAATCGAGCAGCAGCTCTCGATGCTCACCGGCGAAGCGCGGGCA
CGGGACCGAATCGCGACACGACTGCGAGCCCTCCACGAGAAGTGGAACAGCGCAGCTGAA
GTACCGACCGGAGCCGATGTCCTGAGCACGCTCGATTCGGCGACGCACGACGAGATATTC
GAGTTCATCGACAACGAGCTCGACCTGTCCTGA
[3] KS34..410
[3] AT563..881
[3] methylmalonyl-CoA754..758
[3] KR1194..1369
[3] ACP1470..1540
[4] KS1561..1937
[4] AT2099..2420
[4] malonyl-CoA2290..2294
[4] KR2735..2914
[4] ACP3017..3087
[3] KS100..1230
[3] AT1687..2643
[3] methylmalonyl-CoA2260..2274
[3] KR3580..4107
[3] ACP4408..4620
[4] KS4681..5811
[4] AT6295..7260
[4] malonyl-CoA6868..6882
[4] KR8203..8742
[4] ACP9049..9261

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [561-686]  G3DSA:3.40.366.10 [754-870]  G3DSA:3.40.366.10 [2092-2222]  G3DSA:3.40.366.10 [2290-2410]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1194-1356]  7.60000000000006e-52 PF00106 [2735-2901]  3.09999999999998e-59 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1498-1513]  PS00012 [3045-3060]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1470-1540]  PS50075 [3017-3087]  PS50075
PS50075   ACP_DOMAIN
 [1467-1543]  2.50000000000001e-45 G3DSA:1.10.1200.10 [3015-3090]  2.50000000000001e-45 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
 [1463-1578]  4.19999771339581e-30 SSF47336 [3008-3094]  1.79999754022375e-21 SSF47336
SSF47336   ACP_like
 [1473-1539]  1.6e-12 PF00550 [3020-3086]  2.7e-13 PF00550
PF00550   PP-binding
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [34-284]  1e-99 PF00109 [1561-1812]  1.10000000000001e-97 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [292-410]  4.30000000000003e-48 PF02801 [1820-1937]  1.40000000000001e-47 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [563-881]  4.09999999999995e-104 PF00698 [2099-2420]  3.79999999999991e-65 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [1-27]  4.80000000000001e-12 PF08990
PF08990   Docking
 [2-34]  6.899999633797e-07 SSF101173
SSF101173   Polyketide_synth_docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [561-863]  3.49999466863949e-67 SSF52151 [2096-2389]  4.30000170645869e-68 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [688-753]  1.99999636034521e-19 SSF55048 [2224-2289]  1.39999892049878e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [33-295]  G3DSA:3.40.47.10 [296-458]  9.00000000000011e-129 G3DSA:3.40.47.10 [1564-1824]  G3DSA:3.40.47.10 [1825-1989]  9.00000000000011e-129 G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [26-458]  8.6000633021393e-106 SSF53901 [1554-1990]  3.60002015031011e-104 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1195-1375]  6.20000000000009e-76 G3DSA:3.40.50.720 [2736-2920]  6.20000000000009e-76 G3DSA:3.40.50.720 [2970-2984]  6.20000000000009e-76 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [197-213]  PS00606 [1725-1741]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [565-862]  1.39999277195148e-121 SM00827 [2100-2401]  4.80002938964645e-115 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1471-1543]  1.99999636034521e-34 SM00823 [3018-3090]  1.79999754022375e-32 SM00823
SM00823   PKS_PP
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [36-461]  SM00825 [1564-1990]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1194-1369]  2.99998750445706e-47 SM00822 [2735-2914]  4.50001022902825e-60 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit