close all open/close all

CDS information : Spino_00200


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction44,966 / 59,752 / + [in whole cluster]
44,966 / 59,752 / + [in contig]
Location44966..59752 [in whole cluster]
44966..59752 [in contig]
TypeCDS
Length14,787 bp (4,928 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category1.1 PKS
Productpolyketide synthase
Product (GenBank)polyketide synthase extender modules 5-7
Gene
Gene (GenBank)spnD
EC number
Keyword
Note
Note (GenBank)
  • involved in spinosyn aglycone biosynthesis
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)

close this sectionPKS/NRPS Module

5 malonyl-CoA
6 malonyl-CoA
7 malonyl-CoA
KS38..414
AT576..894
DH942..1104
KR1421..1601
ACP1692..1762
KS1787..2162
AT2320..2642
KR2955..3134
ACP3233..3307
KS3328..3703
AT3862..4181
KR4495..4674
ACP4774..4844

close this sectionSequence

selected fasta
>polyketide synthase [polyketide synthase extender modules 5-7]
MEITMANEEKLFGYLKKVTADLHQTRQRLLAAESRSQEPIAIVSASCRLPGGVDSPEALW
QLVRTGTDAISEFPADRGWDLGRLYDPDPNHQGTSYTRAGGFLAGAGDFDPAMFGISPRE
ALAMDPQQRLLLELSWEALERAGIDPTSLRGSKTGVFGGVTPQEYGPSLQEMSRNAGGFG
LTGRMVSVASGRVAYSFGFEGPAVTVDTACSSSLVALHLACQSLRSGECDLALAGGVTVM
ATPATFVEFSRQRGLAPDGRCKSFAAAADGTGWGEGAGLVLLERLSDARRNGHEVLAVVR
GSAVNQDGASNGLTAPNGPSQQRVITQALASAGLSVSDVDAVEAHGTGTTLGDPIEAQAL
IATYGQGREKDRPLWLGSVKSNIGHTQAAAGVAGVIKMVLAMRHGQLPATLHVDEPTSAV
DWSAGSVRLLTENTPWPDSGRPCRVGVSSFGISGTNAHVILEQSPVEQGEPAGPVEGERE
PDVAVPVVPWVLSGKTPEAARAQAERVHSHIEDRPGLSPVDVAYSLGMTRAALDERAVVL
GSDRAALLTGLRAFADGCDAPEVVSGSVGLGGRVGFVFSGQGGQWPGMGRGLYSVFPVFA
DAFDEACAELDAHLGQELRVRDVVFGSQAWLLDRTVWAQSGLFALQIGLLRLLGSWGVRP
DVVLGHSVGELAAVHAAGVLSLSEAARLVAGRARLMQALPSGGAMLAVATGEFQVDPLLD
GVRDRIGIAAVNGPESVVLSGDRELLTEIADRLHDQGCRTRWLRVSHAFHSPHMEPMLEE
FAQISRGREYHAPELPIISTLIGELDGGRVMGTPEYWVRQVREPVRFAEGVQALVGQGVG
TIVELGPDGALSTLVEECVAESGRVAGIPLMRKDRDEARTVLAALAQIHTRGGEVDWRSF
FAGTGAKQVDLPTYAFQRQRYWLASTGRAGDVTAAGLAEADHPLLGAVVALADGEGVVLT
GRLTAGSHPWLSDHRVLGEIVVPGTAIVELVWHVGERLGCGRVEELALEAPLILPDHGAV
QVQVLVGPPGESGARSVALYSCPGEAIEPEWKKHATGVLLPPVAAENHELTAWPPENATE
IDADGVYAFLEGHGFAYGPAFRCLRGAWRRGGEVFAEVALPDDMQAGVDRFGVHPALLDA
VLHAAAAETSVVQSEARVPFSWRGVELRATESAVVRARLSLTSDDELSLVAVDPAGRFVA
TVDSLVTRPISRQQVRSGAIGDCLFEVEWHRKALLGTTAGDDLAIVGDGPSWPESVRATA
RFATLDEFRAAVDSDVPAPGSVLVAAMSAEEVEGGSLPSRAQESTSDLLALVQSWLADER
FAESQLVVVTRAAVSADSDSDVADLVGASSWGLLSSAQSENPGRFVLVDVDGTPESWQAL
PAAVRAGEPQLALRRGVALVPRLARLTVREEGSSPQLDTDGTVLITGGTGALGGVVARHL
VEEHGIRRLVLAGRRGWNAPGVHELVDELARAGAVVEVVACDVADRTDLEHVLAAIPVDW
PLRGIVHTAGVLADGVIGSLSAADVGTVFAPKVTGAWHLHELTRDLDLSFFVLFSSFSGI
AGAAGQANYAAANTFLDALARYRRARGLPGLSLAWGLWAQPSGMTSGLDAASVERLARTG
IAELSTEDGLRLFDAAFAKDRACVVAARLDRALLVGNGRSHAIPALLSALVPVRGGVARK
TANSQAADEDALLGLVREHVSAVLGYSGAVEVGGDRAFRDLGFDSLSGVELRNRLAGVLG
VRLPATAVFDYPTPRALARFLHQELAGEVASTSTPVTRAASAEEDLVAIVGMGCRFPGGV
SSPEELWRLVAGGVDAVAGFPDDRGWDLAALYDPDPDRLGTSYVCEGGFLRDAAEFDADM
FGISPREALAMDPQQRLLLEVAWETLERAGIDPFSLHGSRTGVFAGLMYHDYGARFITRA
PEGFEGHLGTGNAGSVLSGRVAYSFGFEGPAVTVDTACSSSLVALHLAGQALRAGECEFA
LAGGVTVMSTPTTFVEFSRQRGLAPDGRCKSFAAAADGTGWGEGAGLVLLERLSDARRNG
HEVLAVVRGSAVNQDGASNGLTAPNGPSQQRVITQALTSAGLSVSDVDAVEAHGTGTRLG
DPIEAQALIATYGRDRDPGRPLWLGSVKSNIGHTQAAAGVAGVIKMVMAMRQGELPRTLH
VDEPSAQVDWSAGTVQLLTENTPWPDSGRLRRAGVSSFGISGTNAHLILEQPPRESQRST
EPDSGSVRDFPVVPWMVSGKTPEALSAQADALMSYLSNRVDASPRDIGYSLAVTRPALDH
RAVVLGADRAALLPGLKALAVSNDAAEVITGTRAAGPVGFVFSGQGGQWPGMGSGLHSAF
PVFADAFDEACCELDAHLGQMARLRDVLSGSDTQLLDQTLWAQPGLFALQVGLWELLGSW
GVRPAVVLGHSVGELAAAFAAGVLSLRDAARLVAGRARLMQALPTGGAMLAAAAGEEQLR
PLLADCGDRVGIAAVNAPGSVVLSGDRDVLDDIAGRLDGQGIRSRWLRVSHAFHSHRMDP
MLAEFTEIARSVDYRSSGLPIVSTLTGELDEVGMPATPEYWVRQVREPVRFADGVAALAA
HGVSTVVEVGPDGVLSALVQECAAGSDQGGRVAAVPLMRSNRDEAHTVTTALAQIHVRGA
EVDWRSFFAGTGAKQVELPTYAFQRQRYWLDSPSEPVGQSADPARQSGFWELVEQEDVSA
LSAALHITGDHDVQASLESVVPVLSSWHRRIRNESLVHQWRYRISWHERADLPDPSLSGT
WLVVVPEGWSASRQVLRFNEMFEERGCPAVLFELAGHDEEALAQRFRSLPVASGGISGVL
SLLALDESPSSPNAALPNGALNSLVLLRALRAADVSAPLWLATCGGVAVGDVPVNPGQAL
VWGLGRVVGLEHPAWWGGLVDVPCLLDEDARERLSVVLAGLGEDEIAVRPGGVFVRRLER
AGAASGAGSVWRPRGTVLVTGGTGGLGAHVARWLAGAGAEHVVLTSRRGAAAPGAGDLRA
ELEALGARVSITACDVADRDALAEVLATIPDDCPLTAVMHAAGVVEVGDVASMCLTDFVG
VLSAKAGGAANLDELLADVELDAFVLFSSVSGVWGAGGQGAYAAANAYLDALAQQRRARG
LVGTAVAWGPWAGDGMAAGEGGAQLRRAGLVPMAADRALLALQGALDRDETSLVVADMAW
ERFAPVFAMSRRRPLLDELPEAQQALADAENTTDAADSAVPLPRLAGMAAAERRRAMLDL
VLAEASIVLGHNGSDPVGPDRAFQELGFDSLMAVELRNRLGEATGLSLPATLIFDYPSPS
ALAEQLVGELVGAQPATTVVAGADPVDDPVVVVAMGCRYPGDVCSPEELWQLVSAGRDAV
STFPVDRGWDCNTLFDPDPDRAGSTYVREGAFLTGADRFDAGFFGISPREARAMDPQQRL
LLEVAWEVFERAGIAPLSLRGSRTGVFAGTNGQDHGAKVAAAPEAAGHLLTGNAASVLAG
RLSYTFGLEGPAVAVDTACSSSLVALHLACQSLRSGECDMALAGGVTVMSTPLAFLEFSR
QRGLAPDGRCKSFAAAADGTGWGEGAGLVLLERLSDARRNGHRVLAVVRGSAVNQDGASN
GLTAPNGPSQQRVIRQALANAGLSASDVDVVEAHGTGTGLGDPIEAQALIATYGQERDPE
RALWLGSIKSNIGHTQAAAGVAGVIKMVQAMRHGELPATLHVDKPTPQVDWSAGAVRLLT
GNTPWPESGRPRRAGVSSFGISGTNAHLILEQPPSEPAEIDQSDRRVTAHPAVIPWMLSA
RSLAALQAQAAALQARLDRGPGASPLDLGYSLATTRSVLDERAVVWGADREALLSRLAAL
ADGRTAPGVITGSANSGGRIGFVFSGQGSQWLGMGKALCAAFPAFADAFEEACDALSAHL
GADVRGVLFGADEQMLDRTLWAQSGIFAVQVGLLGLLRSWGVRPAAVLGHSVGELAAAHA
AGVLSLPDAARLVAARAHLMQALPTGGAMLAVATSEAAVGPLLSGVCDRVSIAAINGPES
VVLSGDRDVLVELAGEFDARGLRTKWLRVSHAFHSHRMEPILDEYAETARCVEFGEPVVP
IVSAATGALDTTGLMCAADYWTRQVRDPVRFGDGVRALVGQGVDTIVEFGPDGALSALVE
QCLAGSDQAGRVAAIPLMRRDRDEVETAVAALAHVHVRGGAVDWSACFAGTGARTVELPT
YAFQRQRYWLAGQADGRGGDVVADPVDARFWELVERADPEPLVDELCIDRDQPFREVLPV
LASWREKQRQEALADSWRYQVRWRSVEVPSAAALRGVWLVVLPADVPRDQPAVVIDALIA
RGAEVAVLELTEQDLQRSALVDKVRAVIADRTEVTGVLSLLAMDGMPCAAHPHLSRGVAA
TVILTQVLGDAGVSAPLWLATTGGVEAGTEDGPADPDHGLIWGLGRVVGLEHPQWWGGLI
DLPETLDETSRNGLVAALAGTAAEDQLAVRSSGLFVRRVVRAARNPRSETWRSRGTVLIT
GGTGALGAEVARWLARRGAEHLVLISRRGPEAPGAADLGAELTELGVKVTVLACDVTDRD
ELAAVLAAVPTEYPLSAVVHTAGVGTPANLAETTLAQFADVLSAKVVGAANLDRLLGGQP
LDAFVLFSSISGVWGAGGQGAYSAANAYLDALAERRRACGRPATCIAWGPWAGAGMAVQE
GNEAHLRRRGLVPMEPQSALFALQQALSQRETAITVADVDWERFAASFTAARPRPLLEEI
VDLRPDTETEEKHGAGELGQQLAALPPAERGHLLLEVVLAETASTLGHDSAEAVQPDRTF
AELGFDSLTAVELRNRLNAVTGLRLPPTLVFDHPTPLALSEQLVPALVAEPDNGIESLLA
ELDRLDTTLAQGPSIPLEDQAKVAERLHALLAKWDGARDGTARATSPQSLTAATDDEIFD
LIDRKFRR
selected fasta
>polyketide synthase [polyketide synthase extender modules 5-7]
GTGGAAATCACAATGGCCAATGAAGAAAAGCTCTTCGGCTATCTGAAGAAGGTAACTGCG
GACCTGCATCAGACCCGGCAGCGCCTGCTCGCGGCCGAGAGCCGGAGTCAGGAGCCGATC
GCGATCGTCTCGGCGAGCTGCCGACTGCCCGGCGGCGTCGACTCTCCCGAAGCGCTCTGG
CAACTCGTGCGCACTGGCACCGACGCCATCTCGGAGTTCCCCGCCGACCGGGGCTGGGAT
CTCGGCCGGTTGTACGATCCCGACCCGAACCACCAGGGAACGTCGTACACGCGGGCCGGC
GGTTTCCTCGCAGGAGCGGGCGATTTCGACCCCGCCATGTTCGGGATTTCGCCGCGTGAG
GCGTTGGCGATGGACCCGCAGCAACGGTTGTTGCTGGAGCTGTCCTGGGAGGCCCTCGAA
CGGGCGGGCATAGACCCGACATCCCTGCGCGGCAGCAAGACCGGTGTCTTCGGTGGTGTC
ACGCCCCAGGAGTACGGGCCGTCCTTGCAGGAGATGAGCCGAAACGCTGGGGGTTTTGGA
CTCACCGGGCGGATGGTGAGTGTGGCGTCGGGTCGGGTTGCGTATTCGTTTGGTTTTGAG
GGTCCTGCGGTGACGGTGGATACGGCGTGTTCGTCGTCGTTGGTGGCCCTGCATTTGGCG
TGTCAGTCGTTGCGTTCCGGCGAATGCGATCTCGCGCTGGCCGGCGGTGTGACGGTGATG
GCGACACCGGCGACGTTCGTGGAGTTCTCCCGTCAGCGTGGTTTGGCTCCGGACGGGCGG
TGCAAGTCGTTCGCGGCTGCCGCGGATGGCACCGGGTGGGGTGAGGGTGCCGGTCTGGTG
TTGCTGGAGCGGTTGTCGGATGCGCGGCGGAATGGGCACGAGGTTCTGGCGGTGGTGCGG
GGTAGCGCGGTGAACCAGGACGGCGCGTCGAATGGTTTGACTGCGCCGAATGGTCCGTCG
CAGCAGCGGGTGATCACCCAGGCGTTGGCGAGTGCGGGGCTGTCGGTTTCCGATGTGGAT
GCGGTCGAGGCACATGGGACCGGGACCACGTTGGGTGATCCGATCGAGGCACAGGCCCTG
ATCGCCACGTACGGGCAGGGCCGGGAGAAGGATCGGCCGTTGTGGTTGGGGTCGGTCAAG
TCCAACATCGGTCACACGCAGGCGGCCGCTGGCGTTGCCGGCGTCATCAAGATGGTCTTG
GCGATGCGGCACGGGCAGCTGCCCGCCACGTTGCATGTGGATGAGCCCACGTCGGCGGTG
GACTGGTCGGCGGGTTCGGTCCGGCTTCTCACGGAGAACACGCCCTGGCCGGACAGTGGT
CGTCCTTGCCGGGTGGGGGTGTCGTCGTTCGGGATCAGCGGCACCAACGCACATGTGATT
CTCGAACAGTCTCCAGTCGAGCAGGGCGAACCGGCCGGGCCGGTCGAAGGCGAGCGGGAA
CCGGATGTAGCCGTCCCCGTGGTGCCTTGGGTGCTGTCGGGTAAGACACCGGAGGCTGCG
CGGGCGCAGGCCGAACGGGTGCATTCGCATATCGAGGACCGGCCGGGGCTGTCGCCGGTG
GATGTGGCGTATTCGCTAGGAATGACACGCGCGGCGCTGGATGAACGCGCAGTGGTGTTG
GGCTCGGACCGTGCCGCGCTCCTGACCGGGTTGAGGGCATTCGCCGACGGCTGCGATGCG
CCCGAAGTGGTTTCGGGGTCTGTGGGGCTTGGTGGCCGCGTCGGGTTCGTGTTCTCGGGT
CAGGGTGGTCAGTGGCCGGGGATGGGCCGGGGGCTCTACTCGGTGTTTCCGGTGTTCGCC
GACGCGTTCGACGAGGCTTGCGCGGAGTTGGATGCACACCTGGGCCAGGAACTGCGGGTT
CGGGATGTGGTGTTCGGTTCGCAAGCGTGGTTGCTGGATCGGACGGTGTGGGCGCAGTCG
GGTTTGTTCGCGTTGCAGATTGGCTTGCTGCGGCTGCTGGGTTCGTGGGGTGTTCGGCCG
GATGTGGTGTTGGGGCACTCGGTGGGTGAGCTGGCTGCGGTGCATGCGGCTGGTGTGTTG
TCGTTGTCGGAGGCCGCGCGGTTGGTGGCGGGTCGCGCCCGGTTGATGCAGGCGTTGCCT
TCTGGTGGTGCCATGCTCGCGGTCGCTACGGGTGAGTTTCAGGTCGATCCTCTGCTGGAT
GGGGTGCGGGACCGGATCGGTATCGCGGCGGTGAATGGCCCGGAATCGGTTGTGCTCTCT
GGTGACCGCGAGCTGCTCACCGAGATCGCTGATCGGTTGCACGATCAGGGGTGCCGGACC
CGGTGGTTGCGGGTGTCGCATGCTTTCCATTCGCCCCATATGGAGCCGATGCTGGAGGAG
TTCGCCCAGATCTCCCGAGGCCGCGAATATCACGCACCGGAACTGCCGATCATCTCGACC
CTGATCGGTGAGCTGGACGGTGGTCGAGTGATGGGCACTCCCGAGTACTGGGTGCGTCAG
GTGCGTGAGCCCGTCCGTTTCGCCGAGGGTGTCCAGGCGCTTGTCGGTCAGGGTGTCGGC
ACGATTGTCGAATTGGGTCCGGACGGGGCGTTGTCGACGTTGGTCGAGGAGTGTGTGGCG
GAATCCGGGCGGGTGGCCGGGATCCCGCTGATGCGCAAGGACCGCGACGAGGCGCGAACC
GTGCTGGCAGCTTTGGCGCAGATCCACACCCGTGGTGGTGAGGTGGACTGGCGGTCGTTT
TTCGCCGGTACCGGGGCGAAGCAAGTCGACCTGCCCACCTACGCCTTCCAGCGGCAGCGG
TACTGGCTGGCATCCACCGGGCGTGCGGGTGACGTGACCGCCGCCGGATTGGCCGAGGCG
GACCATCCGCTGCTCGGTGCGGTGGTTGCGTTGGCAGACGGCGAAGGTGTGGTGCTGACC
GGTCGGTTGACAGCGGGTTCGCATCCGTGGTTGTCCGATCACCGGGTGCTGGGCGAAATC
GTCGTCCCCGGCACCGCGATCGTCGAGCTGGTGTGGCACGTCGGCGAGCGCCTCGGTTGT
GGCCGGGTGGAAGAACTGGCTTTGGAAGCGCCCCTGATCCTGCCGGATCATGGAGCGGTC
CAGGTTCAGGTGCTGGTGGGACCGCCCGGGGAATCCGGAGCCCGGTCGGTGGCGCTCTAC
TCCTGTCCTGGCGAGGCGATCGAACCCGAGTGGAAGAAGCACGCGACGGGCGTGCTTCTC
CCACCCGTGGCCGCCGAGAACCATGAGCTGACCGCATGGCCCCCGGAGAATGCGACCGAA
ATCGATGCAGACGGGGTCTACGCATTCCTTGAAGGGCACGGTTTCGCGTACGGACCGGCC
TTTAGATGTCTGCGCGGTGCCTGGCGACGAGGCGGGGAGGTGTTCGCCGAAGTCGCATTG
CCGGATGACATGCAGGCGGGGGTCGATCGATTCGGCGTCCACCCCGCGTTGCTGGACGCG
GTTCTGCATGCCGCCGCAGCCGAGACGTCGGTGGTCCAGAGCGAAGCGCGGGTGCCGTTC
TCGTGGCGTGGGGTGGAACTTCGCGCCACTGAAAGCGCGGTGGTGCGGGCGCGCCTCTCG
TTGACTTCGGATGACGAACTGTCGTTGGTCGCAGTGGACCCGGCTGGCCGATTCGTGGCC
ACGGTTGATTCGCTGGTGACCCGACCGATCTCCCGGCAGCAGGTGAGGTCTGGCGCGATC
GGTGATTGCCTGTTCGAGGTGGAGTGGCACCGGAAGGCGTTGTTGGGAACAACCGCCGGC
GACGACCTTGCCATCGTCGGTGACGGTCCCAGTTGGCCGGAATCGGTGCGCGCAACCGCA
CGGTTCGCGACCCTGGATGAGTTCCGTGCGGCCGTGGACTCGGACGTTCCTGCCCCGGGT
TCGGTGTTGGTCGCAGCTATGTCGGCCGAAGAGGTCGAGGGTGGATCCCTGCCGTCGCGC
GCCCAAGAGTCGACCTCCGATCTGCTGGCTCTCGTGCAGTCGTGGCTTGCGGACGAGCGG
TTCGCCGAATCCCAGCTCGTGGTCGTCACGCGTGCAGCGGTGTCGGCCGACTCGGATTCG
GACGTCGCGGACCTGGTGGGTGCGTCGTCGTGGGGGTTGTTGAGTTCAGCCCAGTCGGAG
AACCCGGGTCGCTTCGTGCTGGTGGACGTGGACGGCACACCTGAGTCGTGGCAGGCGTTG
CCGGCCGCCGTGCGAGCAGGAGAACCGCAGCTGGCACTTCGGCGCGGCGTGGCGCTGGTG
CCTCGGTTGGCGCGACTCACGGTGCGCGAGGAGGGCTCCTCCCCGCAACTCGACACGGAC
GGGACCGTCCTCATCACGGGTGGCACCGGTGCGTTGGGGGGAGTGGTTGCCCGTCACCTG
GTGGAGGAGCACGGGATTCGGCGTTTGGTGTTGGCAGGCCGGCGTGGCTGGAATGCGCCT
GGAGTCCACGAGTTGGTGGATGAGCTGGCGCGCGCGGGCGCCGTGGTTGAGGTGGTGGCT
TGCGATGTGGCTGACCGCACCGATCTGGAGCACGTGCTGGCCGCCATTCCGGTCGACTGG
CCGCTGCGGGGGATCGTGCATACCGCTGGGGTGCTGGCCGACGGAGTGATCGGGTCCTTG
TCGGCGGCGGATGTGGGCACGGTGTTTGCCCCGAAGGTGACGGGGGCATGGCATCTGCAC
GAGTTGACCCGCGATCTGGATCTGTCGTTCTTCGTTCTTTTCTCTTCCTTCTCCGGGATT
GCGGGTGCCGCAGGGCAGGCCAACTACGCGGCGGCGAACACGTTCCTGGATGCATTGGCG
CGTTATCGCCGGGCGCGTGGGCTGCCTGGGTTGTCGTTGGCGTGGGGACTGTGGGCGCAA
CCCAGCGGTATGACGAGTGGCTTGGACGCGGCGTCGGTGGAGCGGTTGGCGCGGACGGGC
ATCGCAGAACTTTCCACGGAGGATGGACTCCGCCTGTTCGATGCCGCGTTCGCGAAGGAC
CGGGCTTGCGTCGTTGCCGCTCGATTGGACAGGGCGCTGCTGGTCGGGAACGGACGATCG
CACGCGATTCCGGCGCTGTTGAGCGCGTTGGTTCCTGTTCGCGGCGGTGTGGCGAGGAAA
ACAGCCAATTCTCAGGCCGCGGATGAGGACGCACTGTTGGGTTTGGTGCGGGAGCACGTT
TCGGCCGTGCTGGGTTATTCGGGTGCGGTCGAGGTTGGGGGCGACCGTGCTTTCCGTGAT
CTGGGTTTTGATTCGTTGTCTGGCGTGGAGTTGCGGAACCGCCTTGCCGGGGTGCTGGGG
GTGCGGTTGCCGGCGACTGCGGTGTTCGACTATCCGACGCCGCGGGCGCTGGCGCGTTTC
CTGCATCAGGAACTGGCAGGCGAGGTCGCGTCCACGTCGACGCCGGTGACCAGGGCAGCG
AGTGCCGAAGAGGATCTTGTTGCGATTGTCGGGATGGGATGTCGTTTTCCGGGTGGGGTG
TCGTCGCCGGAGGAGCTTTGGCGGCTGGTGGCCGGCGGCGTGGATGCGGTGGCTGGGTTC
CCAGACGATCGCGGCTGGGATCTCGCGGCGTTGTACGATCCTGATCCCGATCGTCTCGGG
ACCTCGTATGTGTGTGAGGGCGGGTTTCTGCGGGACGCGGCGGAGTTCGATGCTGACATG
TTCGGCATCAGCCCGCGTGAGGCGTTGGCGATGGATCCGCAGCAGCGGTTGCTGCTGGAG
GTCGCCTGGGAAACCTTGGAGCGGGCTGGGATCGATCCGTTCTCGTTGCACGGCAGCCGG
ACCGGTGTGTTCGCGGGCTTGATGTACCACGACTATGGGGCCCGATTCATTACCAGAGCA
CCGGAGGGCTTCGAAGGGCACCTCGGGACGGGCAATGCGGGGAGCGTGCTGTCGGGTCGG
GTTGCGTATTCGTTTGGTTTCGAGGGTCCTGCGGTGACGGTGGATACGGCGTGTTCGTCG
TCGTTGGTGGCGTTACACCTGGCGGGTCAAGCACTGCGGGCCGGTGAGTGCGAATTCGCC
CTTGCCGGTGGCGTCACGGTGATGTCGACGCCGACGACGTTCGTGGAGTTCTCCCGTCAA
CGGGGTCTGGCTCCGGATGGGCGGTGCAAGTCGTTCGCGGCGGCCGCGGATGGCACCGGG
TGGGGCGAGGGTGCCGGTCTGGTGTTGCTGGAGCGGTTGTCGGATGCCCGGCGCAATGGG
CACGAGGTTCTGGCGGTGGTGCGGGGTAGCGCGGTGAACCAGGACGGCGCGTCGAATGGC
TTGACTGCGCCAAATGGTCCGTCACAGCAAAGGGTGATCACCCAGGCACTCACGAGTGCC
GGGCTGTCCGTGTCCGACGTGGATGCTGTGGAGGCGCATGGGACGGGCACGCGGCTTGGT
GATCCGATCGAGGCGCAGGCGTTGATCGCTACGTACGGCCGGGATCGTGATCCCGGTCGG
CCGTTGTGGCTGGGGTCGGTGAAGTCGAATATTGGTCACACCCAGGCGGCGGCGGGTGTC
GCTGGTGTGATCAAGATGGTGATGGCGATGCGGCAGGGGGAGCTGCCGCGCACGTTGCAC
GTGGACGAGCCCTCCGCGCAGGTGGACTGGTCTGCGGGCACGGTCCAACTCCTCACGGAG
AACACGCCCTGGCCCGACAGCGGTCGTCTTCGCCGGGCGGGCGTGTCATCGTTCGGGATC
AGTGGCACCAACGCGCACCTGATCCTTGAACAACCTCCGCGAGAGTCGCAGCGCTCAACA
GAGCCGGATTCGGGTTCTGTCCGCGATTTTCCGGTGGTGCCGTGGATGGTGTCGGGCAAA
ACACCCGAAGCGCTATCCGCCCAGGCAGATGCATTGATGTCCTACTTGAGCAATCGCGTT
GATGCTTCCCCGCGAGATATCGGTTATTCGCTTGCGGTGACCCGTCCGGCGTTGGACCAC
CGCGCTGTCGTGCTGGGTGCGGATCGTGCCGCGTTGCTGCCGGGCTTGAAAGCGCTGGCC
GTTAGTAATGACGCTGCCGAGGTGATCACCGGCACTCGTGCCGCTGGGCCGGTCGGATTC
GTGTTCTCCGGTCAAGGTGGTCAGTGGCCCGGGATGGGAAGCGGGCTCCACTCGGCGTTT
CCGGTGTTCGCCGACGCGTTTGACGAAGCCTGCTGCGAGCTGGATGCGCATCTCGGGCAG
ATGGCCCGGCTACGAGATGTGTTGTCCGGTTCGGATACGCAACTTCTGGACCAGACCTTG
TGGGCGCAGCCGGGCCTGTTCGCGTTGCAAGTCGGACTCTGGGAGTTGTTGGGTTCGTGG
GGTGTCCGGCCCGCTGTGGTGCTGGGCCACTCGGTCGGTGAGCTGGCGGCGGCGTTCGCG
GCTGGAGTGTTGTCGTTGCGGGATGCGGCTCGGCTGGTGGCGGGCCGTGCCCGGTTGATG
CAAGCCCTGCCAACTGGCGGTGCCATGCTCGCTGCGGCTGCTGGAGAGGAGCAGCTGCGC
CCGTTGCTGGCCGACTGCGGTGATCGTGTGGGGATCGCCGCGGTCAACGCTCCCGGGTCG
GTGGTGCTCTCCGGTGATCGGGATGTGCTCGATGACATTGCCGGTCGGCTGGACGGGCAA
GGGATCCGGTCCAGGTGGTTGCGGGTTTCGCATGCGTTTCATTCGCATCGGATGGATCCG
ATGCTGGCGGAGTTCACCGAAATCGCCCGGAGCGTGGACTACCGGTCGTCAGGGCTGCCG
ATCGTGTCGACGTTGACGGGTGAGCTCGATGAGGTCGGCATGCCGGCTACGCCGGAGTAT
TGGGTGCGCCAGGTGCGAGAACCCGTCCGCTTCGCCGACGGTGTTGCTGCGCTCGCGGCT
CACGGTGTGAGCACCGTCGTCGAGGTCGGTCCGGATGGGGTGTTGTCGGCGCTGGTGCAG
GAGTGCGCGGCCGGATCCGATCAGGGCGGACGGGTGGCCGCGGTTCCGCTCATGCGCAGC
AATCGCGACGAGGCGCACACGGTGACAACGGCATTGGCGCAGATCCATGTGCGTGGTGCT
GAGGTGGACTGGCGGTCGTTTTTCGCCGGTACCGGGGCAAAGCAGGTCGAGCTGCCCACG
TATGCCTTCCAACGACAGCGGTACTGGCTTGACTCACCATCCGAACCGGTCGGGCAATCC
GCCGATCCCGCGCGCCAGTCGGGCTTCTGGGAACTCGTCGAGCAGGAAGATGTCAGCGCG
CTCAGCGCCGCTCTGCACATTACCGGCGATCACGACGTGCAGGCGTCCCTGGAATCGGTG
GTTCCGGTCCTCTCCTCCTGGCATCGCCGGATCCGCAACGAATCCCTGGTGCACCAGTGG
CGGTACCGGATTTCCTGGCATGAGCGGGCAGATTTGCCAGACCCCTCGTTGTCGGGGACA
TGGCTCGTCGTCGTGCCGGAGGGGTGGTCGGCGAGTCGGCAAGTTCTGCGTTTCAACGAG
ATGTTCGAGGAACGGGGTTGCCCGGCAGTTCTGTTCGAGCTCGCCGGGCACGACGAGGAA
GCCCTGGCGCAACGATTCCGCTCGTTGCCTGTTGCGTCAGGGGGAATAAGCGGCGTGTTG
TCCTTGCTGGCGCTGGATGAATCGCCGTCCTCGCCGAACGCTGCTTTGCCGAATGGCGCG
CTGAACTCGTTGGTACTGCTGCGAGCTCTGCGGGCCGCGGATGTGTCGGCGCCATTGTGG
TTGGCGACGTGTGGTGGTGTCGCGGTCGGGGATGTGCCGGTGAACCCGGGGCAGGCGCTG
GTGTGGGGACTGGGTCGCGTCGTCGGTCTGGAGCATCCGGCCTGGTGGGGTGGCCTGGTC
GACGTGCCGTGCTTGCTCGATGAGGACGCTCGAGAACGCTTGTCGGTCGTGTTGGCAGGT
CTTGGCGAGGACGAGATCGCGGTACGTCCCGGTGGTGTGTTCGTGCGGCGGTTGGAACGC
GCTGGTGCGGCGTCGGGTGCCGGGTCGGTGTGGCGTCCTCGGGGGACGGTGTTGGTGACG
GGTGGTACGGGCGGTTTGGGGGCGCATGTTGCCCGGTGGTTGGCGGGTGCCGGGGCTGAG
CATGTGGTGTTGACCAGCCGTCGAGGCGCGGCGGCTCCGGGCGCTGGAGATTTGCGGGCG
GAGCTGGAGGCGCTGGGCGCTCGGGTTTCGATCACGGCCTGCGACGTGGCCGATCGTGAC
GCTTTGGCCGAAGTGTTGGCGACCATTCCGGATGATTGCCCGCTGACCGCGGTGATGCAT
GCGGCGGGGGTCGTTGAAGTCGGCGACGTGGCGTCGATGTGTTTGACCGACTTCGTTGGG
GTGCTGTCGGCGAAGGCAGGTGGTGCGGCGAATCTCGATGAGTTGCTCGCCGATGTCGAG
CTGGATGCCTTCGTGCTGTTCTCATCCGTCTCGGGTGTGTGGGGTGCTGGCGGGCAGGGC
GCTTATGCGGCGGCGAATGCCTACTTGGATGCGTTGGCGCAGCAGCGTCGGGCAAGGGGG
TTGGTGGGGACTGCGGTTGCGTGGGGCCCGTGGGCCGGTGACGGAATGGCCGCAGGTGAA
GGCGGTGCACAGCTGCGCCGGGCCGGCCTGGTGCCAATGGCTGCGGATCGGGCGTTGCTG
GCACTTCAGGGCGCATTGGATCGTGACGAGACATCCCTGGTCGTGGCCGATATGGCGTGG
GAGAGGTTCGCCCCGGTGTTCGCCATGTCCCGTCGGCGTCCGCTGCTCGACGAGCTGCCC
GAAGCACAGCAGGCGTTGGCGGATGCGGAGAACACCACTGATGCTGCGGACTCGGCCGTC
CCGCTACCGCGGCTCGCGGGCATGGCAGCCGCCGAACGCCGCCGCGCGATGCTGGACCTG
GTGCTGGCGGAGGCCTCGATTGTGTTGGGACACAACGGGTCTGACCCAGTTGGTCCCGAC
CGGGCGTTCCAGGAGCTCGGATTTGATTCGCTGATGGCCGTCGAACTGCGCAACAGGTTG
GGCGAGGCAACAGGATTGAGTCTGCCGGCCACGTTGATCTTCGATTATCCGAGCCCATCC
GCGCTGGCTGAGCAGCTGGTCGGCGAGCTGGTGGGAGCGCAGCCCGCGACCACCGTCGTG
GCCGGGGCCGATCCAGTGGATGATCCGGTTGTCGTGGTCGCGATGGGATGCCGGTATCCG
GGCGACGTCTGCTCGCCCGAGGAGCTGTGGCAGCTGGTTTCTGCGGGACGTGATGCGGTA
TCGACGTTCCCCGTCGATCGGGGTTGGGACTGCAACACGTTGTTCGACCCGGATCCGGAT
CGGGCAGGCAGTACCTATGTGCGAGAAGGTGCCTTCCTGACCGGTGCTGATCGGTTCGAC
GCCGGGTTCTTCGGCATCAGCCCTCGCGAGGCGCGCGCAATGGATCCGCAGCAGAGGTTG
TTGCTCGAAGTGGCGTGGGAGGTTTTCGAACGAGCAGGAATCGCTCCGCTGTCGTTGCGG
GGTAGCAGGACCGGTGTGTTCGCGGGGACCAATGGGCAGGACCACGGTGCGAAAGTGGCT
GCCGCGCCGGAGGCGGCGGGTCACCTCCTGACCGGAAACGCCGCGAGTGTCCTGGCCGGC
CGGCTTTCCTACACGTTCGGCCTTGAGGGGCCTGCGGTGGCGGTGGATACCGCGTGTTCG
TCGTCGTTGGTGGCGTTGCATTTGGCGTGCCAGTCGCTGCGTTCGGGTGAGTGTGATATG
GCGTTGGCAGGTGGTGTGACGGTGATGTCGACACCCCTGGCTTTCCTCGAGTTCTCTCGT
CAGCGCGGTTTGGCGCCAGATGGTCGGTGCAAGTCGTTTGCGGCCGCTGCGGATGGCACC
GGGTGGGGTGAGGGTGCCGGCCTGGTGTTGCTGGAGCGGTTGTCGGATGCTCGTCGGAAT
GGTCACCGGGTGTTGGCCGTGGTTCGCGGGTCTGCGGTGAATCAGGATGGTGCGTCGAAT
GGCCTGACTGCGCCGAATGGTCCGTCGCAGCAGCGGGTGATTCGGCAGGCCCTCGCGAAT
GCGGGGCTGTCGGCGTCCGATGTGGATGTCGTGGAGGCGCACGGGACCGGTACCGGGCTC
GGGGATCCGATCGAGGCGCAGGCGCTGATCGCGACATATGGGCAGGAGCGGGATCCTGAG
CGGGCCCTGTGGCTGGGGTCGATCAAGTCCAACATCGGCCACACGCAGGCGGCGGCCGGT
GTGGCGGGGGTCATCAAGATGGTGCAGGCCATGCGGCACGGGGAGTTGCCTGCGACGTTG
CACGTGGACAAGCCCACTCCACAGGTGGACTGGTCTGCCGGGGCCGTTCGGCTCCTCACC
GGGAACACGCCCTGGCCCGAGAGCGGCCGTCCTCGTCGAGCGGGGGTGTCGTCGTTCGGG
ATCAGCGGCACCAACGCACACCTCATCCTCGAACAACCACCGTCGGAACCAGCGGAGATC
GACCAATCGGATCGGCGGGTCACTGCGCATCCAGCGGTGATCCCGTGGATGTTGTCGGCT
AGGAGTCTCGCAGCGCTGCAGGCCCAAGCGGCTGCGCTGCAGGCCCGGCTGGACCGGGGT
CCTGGCGCTTCTCCGCTGGATTTGGGGTATTCACTCGCGACCACTCGTTCTGTGCTGGAC
GAACGCGCCGTCGTGTGGGGTGCCGATCGGGAGGCACTGCTGTCCAGGCTGGCAGCGCTC
GCCGATGGCCGGACGGCGCCGGGGGTGATAACGGGCTCTGCGAATTCCGGTGGCCGCATC
GGATTCGTTTTTTCCGGTCAGGGCAGTCAGTGGCTGGGGATGGGAAAGGCGTTGTGCGCG
GCTTTCCCGGCGTTCGCGGACGCCTTCGAGGAAGCCTGCGACGCGCTAAGCGCACACCTG
GGCGCGGACGTTCGGGGTGTGCTGTTCGGTGCTGATGAGCAGATGCTCGACCGGACGCTG
TGGGCGCAGTCGGGGATCTTCGCGGTTCAAGTCGGCCTCCTGGGATTGCTGAGGTCGTGG
GGCGTGCGGCCGGCCGCGGTGCTGGGGCACTCGGTCGGCGAGTTGGCTGCGGCGCACGCG
GCTGGTGTGTTGTCCTTGCCGGACGCTGCACGGTTGGTTGCGGCTCGGGCCCACCTGATG
CAGGCATTGCCCACCGGCGGCGCAATGCTCGCGGTCGCCACCAGCGAGGCGGCGGTCGGA
CCGCTGCTTTCCGGGGTGTGCGATCGGGTCAGCATCGCTGCGATCAACGGCCCCGAGTCG
GTAGTGCTCTCCGGCGACCGCGATGTGCTCGTGGAGCTCGCAGGCGAATTCGATGCCCGA
GGGCTTAGGACCAAATGGTTGCGGGTCTCCCATGCTTTCCACTCGCACCGGATGGAACCG
ATTCTGGACGAGTACGCGGAAACCGCCAGGTGCGTCGAGTTCGGTGAACCGGTGGTGCCG
ATCGTCTCCGCCGCGACCGGTGCGCTGGACACCACCGGACTGATGTGCGCGGCCGACTAC
TGGACGCGCCAAGTGCGTGATCCTGTCCGCTTCGGAGACGGTGTCCGGGCGCTCGTCGGC
CAAGGCGTGGACACGATCGTCGAGTTCGGCCCGGACGGGGCGTTGTCGGCCCTGGTCGAG
CAGTGCTTGGCCGGGTCCGACCAGGCTGGGAGGGTGGCGGCGATCCCGCTGATGCGCAGG
GACCGCGATGAGGTCGAGACCGCGGTGGCGGCCCTGGCGCACGTGCACGTCCGCGGTGGT
GCGGTGGACTGGTCGGCTTGCTTCGCCGGCACCGGCGCCCGCACCGTCGAGTTGCCCACC
TACGCCTTCCAACGCCAGCGGTACTGGCTGGCCGGGCAAGCGGACGGGCGCGGCGGCGAT
GTGGTTGCCGACCCGGTCGACGCGCGCTTCTGGGAGTTGGTCGAGCGCGCCGATCCGGAA
CCGTTGGTGGATGAACTCTGCATCGACCGGGACCAGCCCTTCCGGGAGGTGCTGCCCGTT
CTGGCTTCCTGGCGCGAGAAACAACGCCAGGAGGCCCTCGCGGATTCCTGGCGCTACCAG
GTGCGCTGGAGGTCCGTCGAGGTGCCGTCCGCAGCCGCCCTCCGGGGCGTGTGGCTGGTG
GTGCTTCCAGCTGACGTGCCCCGAGATCAACCGGCGGTCGTCATCGACGCGCTGATCGCG
CGCGGCGCCGAGGTCGCGGTCCTGGAATTGACCGAGCAGGACCTCCAACGCAGTGCGCTT
GTGGACAAGGTGCGCGCCGTCATTGCGGACCGCACCGAGGTGACGGGTGTGTTGTCTCTG
TTGGCGATGGACGGCATGCCCTGCGCGGCGCATCCGCACCTGTCCCGTGGTGTCGCCGCT
ACCGTGATCCTGACGCAGGTGTTGGGCGATGCGGGTGTTTCCGCCCCGCTGTGGCTGGCC
ACGACCGGTGGCGTCGAGGCCGGGACCGAGGACGGTCCGGCCGATCCGGACCACGGCTTG
ATCTGGGGGCTCGGCAGGGTCGTCGGCCTTGAACATCCGCAGTGGTGGGGTGGCCTGATC
GACCTTCCGGAGACACTGGACGAGACGTCCCGGAACGGGTTGGTGGCCGCACTCGCCGGG
ACGGCGGCCGAAGATCAGCTCGCCGTGCGTTCATCCGGGTTGTTCGTTCGCAGAGTGGTG
CGCGCAGCGCGGAACCCCCGGTCAGAGACATGGCGTAGCCGGGGAACGGTCCTCATCACG
GGCGGAACAGGCGCGCTCGGTGCCGAGGTCGCACGATGGCTGGCCCGGCGGGGAGCTGAG
CACCTGGTGTTGATCAGTCGCCGCGGCCCGGAAGCTCCCGGCGCAGCGGACCTAGGGGCC
GAGCTGACTGAACTCGGCGTGAAAGTCACAGTCTTGGCCTGCGATGTGACGGACCGCGAC
GAGCTGGCGGCGGTGCTGGCGGCCGTTCCCACGGAGTATCCGCTGTCGGCGGTCGTGCAC
ACCGCCGGCGTCGGGACGCCTGCGAACCTGGCCGAGACGACCTTGGCGCAGTTCGCCGAC
GTGTTGTCGGCCAAGGTCGTCGGCGCGGCGAACCTGGACCGGCTGCTTGGCGGGCAACCG
TTGGACGCCTTCGTGCTGTTCTCCTCGATCTCGGGAGTTTGGGGAGCCGGCGGCCAAGGA
GCCTATTCGGCCGCCAATGCGTATCTCGATGCCCTTGCCGAGCGCCGACGGGCTTGCGGG
CGGCCGGCGACGTGCATCGCCTGGGGTCCGTGGGCGGGTGCGGGCATGGCCGTTCAGGAA
GGTAACGAGGCGCATCTCCGCCGAAGGGGCCTGGTACCGATGGAACCGCAGTCGGCCCTC
TTCGCGCTGCAACAGGCCCTGTCCCAACGAGAAACCGCCATCACCGTCGCAGATGTGGAC
TGGGAGCGATTCGCCGCCTCTTTCACCGCGGCCCGCCCGCGACCACTGTTGGAAGAGATC
GTGGATCTACGGCCCGACACCGAGACCGAGGAGAAGCACGGTGCCGGCGAGCTGGGGCAG
CAGCTGGCCGCACTGCCGCCCGCTGAGCGCGGACACCTGCTGCTGGAGGTGGTGCTGGCG
GAAACCGCCAGCACCCTGGGGCACGATTCGGCGGAGGCTGTGCAACCCGATCGGACCTTC
GCCGAACTGGGCTTCGATTCGCTGACCGCGGTAGAGCTGCGCAACAGGTTGAACGCGGTG
ACCGGGCTTCGCCTGCCGCCGACGCTGGTTTTCGACCACCCGACGCCGCTGGCGTTGTCC
GAACAGTTGGTTCCGGCCCTGGTCGCGGAGCCGGACAACGGCATCGAATCGCTGCTCGCC
GAGCTCGACAGGCTGGATACCACGTTGGCGCAAGGGCCTTCGATCCCACTGGAAGACCAG
GCCAAGGTGGCGGAGCGCTTGCACGCACTCCTCGCCAAGTGGGACGGGGCGCGTGACGGC
ACGGCCAGAGCGACGTCACCCCAATCGCTGACGGCGGCCACGGACGACGAAATCTTCGAC
CTCATCGACCGGAAGTTCCGGCGCTGA
[5] KS38..414
[5] AT576..894
[5] malonyl-CoA767..771
[5] DH942..1104
[5] KR1421..1601
[5] ACP1692..1762
[6] KS1787..2162
[6] AT2320..2642
[6] malonyl-CoA2511..2515
[6] KR2955..3134
[6] ACP3233..3307
[7] KS3328..3703
[7] AT3862..4181
[7] malonyl-CoA4051..4055
[7] KR4495..4674
[7] ACP4774..4844
[5] KS112..1242
[5] AT1726..2682
[5] malonyl-CoA2299..2313
[5] DH2824..3312
[5] KR4261..4803
[5] ACP5074..5286
[6] KS5359..6486
[6] AT6958..7926
[6] malonyl-CoA7531..7545
[6] KR8863..9402
[6] ACP9697..9921
[7] KS9982..11109
[7] AT11584..12543
[7] malonyl-CoA12151..12165
[7] KR13483..14022
[7] ACP14320..14532

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001227 Acyl transferase domain (Domain)
 [573-699]  G3DSA:3.40.366.10 [767-884]  G3DSA:3.40.366.10 [2311-2443]  G3DSA:3.40.366.10 [2511-2631]  G3DSA:3.40.366.10 [3860-3980]  G3DSA:3.40.366.10 [4050-4163]  G3DSA:3.40.366.10
G3DSA:3.40.366.10   Ac_transferase_reg
IPR002198 Short-chain dehydrogenase/reductase SDR (Family)
 [1421-1588]  2.1e-59 PF00106 [4495-4660]  1.29999999999998e-60 PF00106
PF00106   adh_short
IPR006162 Phosphopantetheine attachment site (PTM)
 [1720-1735]  PS00012 [3265-3280]  PS00012 [4802-4817]  PS00012
PS00012   PHOSPHOPANTETHEINE
IPR009081 Acyl carrier protein-like (Domain)
 [1685-1801]  1.29999924468179e-28 SSF47336 [3230-3344]  1.20000117458134e-27 SSF47336 [4766-4861]  1.50000306971104e-21 SSF47336
SSF47336   ACP_like
 [1692-1762]  PS50075 [3233-3307]  PS50075 [4774-4844]  PS50075
PS50075   ACP_DOMAIN
 [1696-1761]  1.5e-11 PF00550 [3241-3305]  1.6e-12 PF00550 [4778-4842]  2.80000000000001e-12 PF00550
PF00550   PP-binding
 [1690-1766]  1.80000000000002e-63 G3DSA:1.10.1200.10 [3235-3310]  1.80000000000002e-63 G3DSA:1.10.1200.10 [4774-4843]  1.80000000000002e-63 G3DSA:1.10.1200.10
G3DSA:1.10.1200.10   ACP_like
IPR013968 Polyketide synthase, KR (Domain)
 [2955-3133]  1.80000000000002e-60 PF08659
PF08659   KR
IPR014030 Beta-ketoacyl synthase, N-terminal (Domain)
 [38-288]  1.20000000000001e-98 PF00109 [1787-2036]  8.60000000000005e-95 PF00109 [3328-3577]  2.09999999999996e-96 PF00109
PF00109   ketoacyl-synt
IPR014031 Beta-ketoacyl synthase, C-terminal (Domain)
 [296-414]  9.60000000000003e-49 PF02801 [2044-2162]  1.70000000000001e-47 PF02801 [3585-3703]  2.19999999999997e-48 PF02801
PF02801   Ketoacyl-synt_C
IPR014043 Acyl transferase (Domain)
 [576-894]  1.5e-66 PF00698 [2320-2642]  1.20000000000001e-65 PF00698 [3862-4181]  1.20000000000001e-67 PF00698
PF00698   Acyl_transf_1
IPR015083 Polyketide synthase, docking (Domain)
 [5-29]  1.8e-13 PF08990
PF08990   Docking
IPR016035 Acyl transferase/acyl hydrolase/lysophospholipase (Domain)
 [573-866]  2.0000139277205e-69 SSF52151 [2317-2607]  1.39999277195148e-67 SSF52151 [3859-4147]  1.09999184471405e-70 SSF52151
SSF52151   Acyl_Trfase/lysoPlipase
IPR016036 Malonyl-CoA ACP transacylase, ACP-binding (Domain)
 [701-766]  3.69999438558106e-17 SSF55048 [2445-2510]  7.49999605851445e-18 SSF55048 [3985-4050]  9.5000102816722e-17 SSF55048
SSF55048   Malonyl_transacylase_ACP-bd
IPR016038 Thiolase-like, subgroup (Domain)
 [37-299]  G3DSA:3.40.47.10 [300-465]  G3DSA:3.40.47.10 [1787-2048]  G3DSA:3.40.47.10 [2049-2215]  G3DSA:3.40.47.10 [3330-3589]  G3DSA:3.40.47.10 [3590-3755]  G3DSA:3.40.47.10
G3DSA:3.40.47.10   Thiolase-like_subgr
IPR016039 Thiolase-like (Domain)
 [30-412]  4.50001022902825e-107 SSF53901 [1777-2214]  4.99996518094122e-104 SSF53901 [3327-3701]  4.60000044330866e-106 SSF53901
SSF53901   Thiolase-like
IPR016040 NAD(P)-binding domain (Domain)
 [1420-1622]  5.59999999999999e-108 G3DSA:3.40.50.720 [2955-3142]  1.69999999999998e-107 G3DSA:3.40.50.720 [4488-4687]  1.69999999999998e-107 G3DSA:3.40.50.720
G3DSA:3.40.50.720   NAD(P)-bd
IPR018201 Beta-ketoacyl synthase, active site (Active_site)
 [201-217]  PS00606 [1949-1965]  PS00606 [3490-3506]  PS00606
PS00606   B_KETOACYL_SYNTHASE
IPR020801 Polyketide synthase, acyl transferase domain (Domain)
 [577-875]  1.3000049540733e-118 SM00827 [2321-2622]  5.50001754266469e-116 SM00827 [3863-4162]  1.90000694315261e-115 SM00827
SM00827   PKS_AT
IPR020806 Polyketide synthase, phosphopantetheine-binding domain (Domain)
 [1693-1765]  7.0999832511256e-34 SM00823 [3238-3310]  3.99998544139406e-35 SM00823 [4775-4847]  1.39999892049878e-32 SM00823
SM00823   PKS_PP
IPR020807 Polyketide synthase, dehydratase domain (Domain)
 [942-1104]  3.19999899046355e-76 SM00826
SM00826   PKS_DH
IPR020841 Polyketide synthase, beta-ketoacyl synthase domain (Domain)
 [40-466]  SM00825 [1787-2214]  SM00825 [3330-3755]  SM00825
SM00825   PKS_KS
IPR020842 Polyketide synthase/Fatty acid synthase, KR (Domain)
 [1421-1601]  5.6999970878395e-65 SM00822 [2955-3134]  2.1000026783403e-58 SM00822 [4495-4674]  1.40000506907309e-61 SM00822
SM00822   PKS_KR
SignalP No significant hit
TMHMM No significant hit