close all open/close all

CDS information : Spino_00220


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction76,932 / 77,528 / + [in whole cluster]
76,932 / 77,528 / + [in contig]
Location76932..77528 [in whole cluster]
76932..77528 [in contig]
TypeCDS
Length597 bp (198 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.4 hypothetical protein
Producthypothetical protein
Product (GenBank)unknown
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF R1
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)

close this sectionSequence

selected fasta
>hypothetical protein [unknown]
MMLKRHRLTTAITGLLGGVLLVSGCGTAAALQSSPAPGHDARNVGMASGGGGGDIGTSNC
SEADFLATATPVKGDPGSFIVAYGNRSDKTCTINGGVPNLKGVDMSNSPIEDLPVEDVRL
PDAPKEFTLQPGQSAYAGIGMVLADSGDPNAHVLTGFQSSLPDMSEAQPVNVLGDGNVKF
AAKYLRVSSLVSTADELR
selected fasta
>hypothetical protein [unknown]
ATGATGCTCAAGCGCCACCGTTTGACGACCGCCATCACCGGCCTTCTGGGGGGAGTACTG
CTGGTCAGCGGCTGCGGAACCGCCGCCGCACTTCAGTCCTCGCCGGCGCCCGGGCATGAC
GCGCGCAATGTTGGTATGGCCTCGGGCGGGGGCGGCGGGGACATCGGCACGTCGAACTGC
TCGGAGGCCGATTTCCTCGCCACCGCGACACCGGTGAAAGGCGACCCCGGCAGTTTCATC
GTGGCGTACGGGAACCGGTCGGACAAGACCTGCACGATCAACGGCGGCGTGCCGAACCTC
AAGGGCGTGGACATGAGCAACTCGCCGATCGAGGACCTGCCGGTCGAGGACGTGCGGCTT
CCCGACGCGCCCAAGGAATTCACCCTCCAGCCCGGTCAGAGCGCGTACGCCGGCATTGGC
ATGGTCCTGGCCGACAGCGGCGACCCGAACGCCCATGTCCTCACCGGGTTCCAGTCCTCG
CTGCCGGACATGTCCGAGGCCCAGCCGGTCAACGTTCTCGGCGACGGCAACGTGAAGTTC
GCCGCGAAGTACCTGCGAGTCAGCTCGCTGGTGTCTACCGCAGACGAGCTGCGCTAA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR025326 Protein of unknown function DUF4232 (Family)
 [60-192]  2.3e-17 PF14016
PF14016   DUF4232
SignalP
 [1-33]  1 Signal
Bacteria, Gram-positive   
 [1-30]  1 Signal
Bacteria, Gram-negative   
 [1-30]  0.94 Signal
Eukaryota   
TMHMM
 [12-31]  Transmembrane (i-o)
Transmembrane 1