close all open/close all
Spino_00220 Spino_00220   last last

CDS information : Spino_00230


close this sectionLocation

Organism
StrainNRRL 18538
Entry nameSpinosyn
Contig
Start / Stop / Direction79,984 / 77,729 / - [in whole cluster]
79,984 / 77,729 / - [in contig]
Locationcomplement(77729..79984) [in whole cluster]
complement(77729..79984) [in contig]
TypeCDS
Length2,256 bp (751 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.2 function unknown
Producthelicase RecD/TraA family protein
Product (GenBank)probable exodeoxyribonuclease V
Gene
Gene (GenBank)
EC number
Keyword
Note
Note (GenBank)
  • ORF R2
Reference
ACC
PmId
[11358695] Cloning and analysis of the spinosad biosynthetic gene cluster of Saccharopolyspora spinosa. (Chem Biol. , 2001)
[11386361] A cluster of genes for the biosynthesis of spinosyns, novel macrolide insect control agents produced by Saccharopolyspora spinosa. (Antonie Van Leeuwenhoek. , 2000)
Family/Domain
FD
IPR006345

close this sectionSequence

selected fasta
>helicase RecD/TraA family protein [probable exodeoxyribonuclease V]
MLSVEKGRESATWTAVLEGTLERITFANEESGYTVARIDTGRGGDLVTVVGALLGAQPGE
ALRMRGRWGSHPQYGRQFHVDDYTTVLPATVQGIRRYLGSGLIKGIGPKLAEKIVDHFGV
AALDVIEQEPARLIEVPKLGPKRTKLIADAWEEQKAIKEVMIFLQGVGVSTSLAVKIYKQ
YHDDAIRTVKEEPYRLAGDVWGIGFKTADTIAKAVGIPHDSPQRVKAGLQFTLSESTGDG
NCYLPENELIAEAVKILAVDTGLVIECLAELVTEEGVVREEIPTDDDEVPTVAIYLVPFH
RAEVALANQLSRLLNTSADRMPVFADVDWHKALDWLRRATGAELAEAQERAVKLALTEKV
AVLTGGPGCGKSFTVRSIIALAQAKKAKVILAAPTGRAAKRLTELTGHDAATVHRLLQLQ
PGGDAAYDRDNPLDADLVVVDEASMLDLLLANKLAKAIAPGAHLLLVGDVDQLPSVGAGE
VLRDLLAPGTPIPHVRLNEVFRQAAESGVVTNAHRINAGDYPLTHGLTDFFLFHVEESEP
TAELTVDVVARRIPRKFRFNPRTDVQVLAPMHRGPAGAGALNQLLQEAITPAREGLPERR
FGGRIFRVGDKVTQIRNNYDKGANGVFNGTQGVVSALDNEAQTMTVRTDEDEDIDYDFTE
LDELVHAYAVTIHRSQGSEYPCVVIPLTTSAWMMLQRNLLYTAVTRAKKVVVLVGSKKAL
GQAVRTVGSGRRHTALDHRLRRGGTGSRPAA
selected fasta
>helicase RecD/TraA family protein [probable exodeoxyribonuclease V]
GTGTTGTCGGTGGAAAAAGGACGGGAGTCGGCCACGTGGACTGCGGTGCTGGAGGGCACG
CTGGAGCGGATCACGTTCGCCAACGAGGAGAGCGGCTACACCGTCGCGCGGATCGACACC
GGCCGGGGCGGTGACCTGGTGACGGTCGTCGGCGCGCTGCTGGGCGCGCAGCCCGGCGAG
GCGTTGCGCATGCGCGGCCGGTGGGGGTCGCACCCCCAGTACGGGCGGCAGTTCCACGTC
GACGACTACACGACCGTGCTGCCTGCGACCGTGCAAGGTATCCGCCGCTACCTGGGGTCT
GGCCTGATCAAGGGCATCGGCCCCAAACTCGCCGAGAAGATCGTCGACCACTTCGGCGTC
GCCGCGCTCGACGTCATCGAGCAGGAACCCGCGCGGCTGATCGAGGTCCCCAAGCTCGGC
CCGAAGCGGACGAAGCTGATCGCCGACGCGTGGGAGGAGCAGAAGGCGATCAAGGAGGTG
ATGATCTTCCTGCAAGGCGTCGGCGTCTCGACCTCGCTGGCGGTGAAGATCTACAAGCAG
TACCACGACGACGCGATCCGGACCGTCAAGGAAGAGCCATACCGGCTGGCAGGCGACGTG
TGGGGAATCGGTTTCAAGACCGCCGACACCATCGCCAAAGCGGTGGGAATCCCGCACGAC
TCCCCGCAGCGGGTAAAGGCGGGCCTTCAGTTCACGCTGTCGGAGTCCACCGGCGACGGC
AACTGCTACCTGCCGGAGAACGAGCTGATCGCCGAGGCGGTGAAGATCCTCGCCGTCGAC
ACCGGGCTGGTGATCGAATGCCTCGCCGAACTCGTCACCGAGGAAGGTGTGGTCCGCGAG
GAGATCCCCACCGATGACGACGAGGTGCCGACGGTCGCGATCTACCTCGTGCCCTTCCAC
CGCGCCGAAGTCGCCCTGGCCAACCAGCTGTCCCGGCTGCTGAACACCAGCGCGGACCGG
ATGCCCGTCTTCGCCGACGTCGATTGGCACAAGGCCCTCGACTGGTTGCGCCGCGCTACC
GGTGCCGAACTCGCCGAGGCGCAGGAGCGCGCCGTCAAGCTGGCCCTGACCGAGAAGGTC
GCCGTGCTCACCGGAGGTCCAGGCTGCGGCAAGAGCTTCACCGTGCGGTCGATCATCGCA
TTAGCTCAGGCGAAAAAGGCCAAGGTGATCCTCGCCGCGCCGACGGGACGAGCGGCGAAG
CGGCTGACCGAGCTCACCGGACACGACGCGGCGACCGTGCACCGCCTGCTCCAACTCCAG
CCGGGCGGGGACGCCGCCTACGACCGGGACAACCCGCTGGACGCCGACCTCGTCGTGGTC
GACGAGGCGTCCATGCTCGACCTGCTGTTAGCCAACAAACTGGCCAAGGCGATCGCGCCC
GGCGCGCACCTGCTGCTGGTCGGCGACGTCGACCAGCTCCCGTCGGTCGGAGCCGGTGAG
GTACTGCGCGATCTGCTCGCCCCTGGCACCCCGATTCCACACGTGCGGCTCAACGAGGTG
TTCCGGCAGGCCGCCGAGTCCGGGGTGGTGACCAACGCGCACCGAATCAACGCCGGGGAC
TATCCGCTGACACACGGGCTGACCGACTTCTTCCTGTTCCACGTAGAGGAAAGCGAACCG
ACCGCCGAGCTCACCGTCGACGTCGTCGCCCGCCGGATTCCGCGGAAGTTCCGGTTCAAC
CCGCGCACCGACGTGCAGGTCCTCGCCCCGATGCATCGAGGCCCCGCAGGTGCAGGCGCG
CTGAACCAGCTGTTGCAGGAAGCGATCACCCCGGCCAGGGAGGGCCTGCCAGAGCGGCGG
TTCGGCGGACGGATCTTCCGCGTCGGCGACAAGGTCACGCAGATCCGCAACAACTACGAC
AAGGGCGCCAACGGCGTGTTCAACGGCACGCAGGGCGTCGTGTCCGCCCTCGACAACGAA
GCACAGACCATGACCGTGCGAACCGACGAGGACGAGGACATCGACTACGACTTCACAGAA
CTCGACGAACTGGTCCACGCCTACGCGGTGACCATCCATCGTTCGCAGGGAAGCGAATAC
CCGTGCGTGGTGATCCCCTTGACCACAAGCGCCTGGATGATGCTGCAGCGCAACCTGCTC
TACACGGCGGTCACCCGGGCCAAGAAGGTCGTGGTCCTCGTCGGTTCGAAAAAGGCCCTC
GGGCAGGCGGTGCGCACCGTCGGCTCCGGCCGCCGCCACACCGCGCTGGACCACCGGCTC
CGACGGGGCGGGACCGGTTCGAGGCCGGCGGCGTGA

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR003583 Helix-hairpin-helix DNA-binding motif, class 1 (Domain)
 [103-117]  0.420000001910726 SM00278 [131-150]  0.550000018117377 SM00278 [195-214]  2.20000006659156 SM00278
SM00278   HhH1
IPR003593 AAA+ ATPase domain (Domain)
 [357-541]  7.39999967908914e-07 SM00382
SM00382   AAA
IPR006345 DNA helicase, RecD/TraA type (Family)
 [18-739]  TIGR01448
TIGR01448   RecD_rel
IPR010994 RuvA domain 2-like (Domain)
 [103-174]  4.79999776836274e-11 SSF47781
SSF47781   RuvA_2_like
SignalP No significant hit
TMHMM No significant hit
Spino_00220 Spino_00220   last last