close all open/close all
first first   Stigm_00020 Stigm_00020

CDS information : Stigm_00010


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction6,231 / 4,978 / - [in whole cluster]
6,231 / 4,978 / - [in contig]
Locationcomplement(4978..6231) [in whole cluster]
complement(4978..6231) [in contig]
TypeCDS
Length1,254 bp (417 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative cytochrome P450
Product (GenBank)cytochrome P450 monooxygenase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in stigmatellin biosynthesis.
Note (GenBank)
  • ORF8
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Related Reference
ACC
P33271
PmId
[1732208] Characterization of Saccharopolyspora erythraea cytochrome P-450 genes and enzymes, including 6-deoxyerythronolide B hydroxylase. (J Bacteriol. , 1992)

close this sectionSequence

selected fasta
>putative cytochrome P450 [cytochrome P450 monooxygenase]
MLRSVSASRPPSPANPVAAFDLARLDDAFYADPFPLYRAMRERDPVHRMPDGSLFLTRWA
DLDCIYRDTRTFSSDKRAEFGAKYGDAPLFEHHTTSLVFNDPPLHTRVRRLIVGALTPRA
LSTMEPGLRTLVDRLLDGLAVKGAADLIEDFAAAIPIEVIGNLLDIPTEERGPLRGWSLA
ILGALEPRLTAEQEACGNEAVTEFLDYLRILVAQRRARPGDPATDVLTRLIQGESDGERL
TETELLHQCVFLLNAGHETTTNLIGNALELLARFPDERARLLRAPALIPTAVEEVLRYES
SNQLGNRRVAEDTEIGGVAVPTGTFLTLCIGAANRDPARFEDPEHFDVGRQPNRHLAFAG
GAHTCAGMNLARIEARIALAAFLARFPDYALTAPPVRARRARFRGFTAMPTRLGSLR
selected fasta
>putative cytochrome P450 [cytochrome P450 monooxygenase]
ATGCTCCGCTCGGTGTCCGCTTCCCGCCCTCCTTCGCCTGCCAACCCCGTCGCCGCCTTC
GACCTCGCGCGACTGGACGACGCCTTCTACGCCGATCCCTTCCCTCTCTACCGCGCGATG
CGGGAGCGAGACCCGGTCCACCGGATGCCCGATGGCTCCCTCTTCCTCACCCGCTGGGCC
GATCTCGACTGCATCTACCGCGACACGCGCACCTTCTCCTCGGACAAGCGCGCCGAGTTC
GGCGCGAAATACGGGGACGCGCCGCTCTTCGAACACCACACCACCTCCCTCGTCTTCAAC
GACCCGCCGCTGCACACGCGGGTGCGCCGACTGATCGTGGGCGCGCTGACGCCGCGCGCG
TTGTCGACAATGGAGCCAGGGTTGCGCACCCTGGTGGACCGGCTGCTGGACGGGCTGGCC
GTGAAGGGCGCCGCAGACCTGATCGAGGACTTCGCCGCCGCCATCCCCATCGAGGTAATT
GGCAACCTGCTGGACATCCCGACGGAGGAGCGGGGGCCGCTGCGGGGCTGGTCGCTCGCG
ATCCTCGGCGCGCTCGAACCCCGTCTGACGGCCGAGCAGGAGGCCTGCGGGAATGAGGCG
GTAACAGAGTTCCTGGACTACCTCCGCATCCTCGTCGCGCAGCGGCGAGCGCGGCCGGGG
GACCCCGCAACGGACGTGCTGACGCGCCTCATCCAGGGCGAATCCGACGGGGAACGATTG
ACCGAGACGGAGCTGCTGCACCAGTGCGTCTTCCTCCTGAACGCGGGGCACGAGACGACA
ACGAACCTCATCGGCAACGCCCTGGAACTGCTGGCGCGCTTCCCGGACGAGCGCGCTCGG
CTGCTGCGAGCCCCCGCGCTGATCCCGACGGCAGTGGAGGAGGTCCTGCGTTACGAATCC
TCCAACCAGCTCGGCAACCGGCGGGTGGCGGAGGACACGGAGATTGGCGGCGTAGCGGTG
CCGACCGGCACCTTCCTCACGCTCTGCATCGGCGCCGCCAACCGCGACCCCGCGCGCTTC
GAGGACCCAGAGCACTTCGACGTGGGGCGCCAGCCCAACCGGCACCTCGCCTTCGCGGGC
GGGGCGCATACGTGCGCGGGGATGAACCTTGCGCGGATAGAGGCGCGGATAGCGTTGGCG
GCGTTCCTCGCGCGCTTCCCGGACTATGCGCTGACCGCACCGCCGGTGAGGGCGCGGCGG
GCGCGGTTCCGCGGGTTCACGGCGATGCCGACGCGGCTGGGGTCCCTGAGGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR001128 Cytochrome P450 (Family)
 [255-272]  1.19999985703101e-05 PR00385 [290-301]  1.19999985703101e-05 PR00385 [356-365]  1.19999985703101e-05 PR00385 [365-376]  1.19999985703101e-05 PR00385
PR00385   P450
 [198-281]  4.7e-07 PF00067 [290-386]  6.19999999999999e-19 PF00067
PF00067   p450
 [6-413]  1e-89 SSF48264
SSF48264   Cytochrome_P450
 [8-413]  1.10000000000001e-104 G3DSA:1.10.630.10
G3DSA:1.10.630.10   Cyt_P450
IPR002397 Cytochrome P450, B-class (Family)
 [100-111]  5.30001985225035e-44 PR00359 [146-162]  5.30001985225035e-44 PR00359 [163-178]  5.30001985225035e-44 PR00359 [206-228]  5.30001985225035e-44 PR00359 [290-301]  5.30001985225035e-44 PR00359 [307-334]  5.30001985225035e-44 PR00359 [335-350]  5.30001985225035e-44 PR00359 [356-365]  5.30001985225035e-44 PR00359 [365-376]  5.30001985225035e-44 PR00359
PR00359   BP450
SignalP
 [1-14]  0.423 Signal
Bacteria, Gram-negative   
TMHMM No significant hit
first first   Stigm_00020 Stigm_00020