close all open/close all

CDS information : Stigm_00020


close this sectionLocation

Organism
StrainSga15
Entry nameStigmatellin
Contig
Start / Stop / Direction6,369 / 7,730 / + [in whole cluster]
6,369 / 7,730 / + [in contig]
Location6369..7730 [in whole cluster]
6369..7730 [in contig]
TypeCDS
Length1,362 bp (453 aa)
Click on the icon to see Genetic map.

close this sectionAnnotation

Category5.1 general function
Productputative protein kinase
Product (GenBank)protein kinase
Gene
Gene (GenBank)
EC number
Keyword
Note
  • This ORF is not involved in stigmatellin biosynthesis.
Note (GenBank)
  • ORF7
Reference
ACC
PmId
[11809757] The biosynthesis of the aromatic myxobacterial electron transport inhibitor stigmatellin is directed by a novel type of modular polyketide synthase. (J Biol Chem. , 2002)
Family/Domain
FD
IPR000719

close this sectionSequence

selected fasta
>putative protein kinase [protein kinase]
MEELISEALPDGSRVGPWRIEGRAGYGTYGAVYRAHRVGRICPRSVALKLARYPNDLRFE
REAELLERVRHANVPRLLGHGTWRAGPQGEAHPYVVMQWVEGVRLYQWNKERLRTAREVL
RVLAQVARALEATHMRGGLHRDVKGENVLVSPEGHASLMDFGCGTWEGAAPLTGGILAPG
TKAYRSPEALRFHWNHRNEADAHYQATPADDVYALGVTAYRLCTGIYPPPATEPSGVGED
ERETQEVKKPPSQVRPLVPALEQLILRMLRDNPKERGRAGELAAEMEALAERAGAEADEP
MNPNHSSVPSEITGRPVSVQREWGGWPVALVLVAVGLLLWGSGSLNTGRRVAPASRMTEG
GTGGVADAAVEALPVSSAAREPEPSGLNLDMLKEPLPGQRRPPCPRFQISIQGGCWLEVP
QSSPPCGESYYEWKGACYSPVAAPPRPRTSDPQ
selected fasta
>putative protein kinase [protein kinase]
ATGGAAGAGCTGATCTCAGAGGCATTGCCGGACGGGAGCCGGGTGGGGCCCTGGAGAATC
GAAGGACGAGCGGGCTACGGGACGTACGGGGCGGTGTACCGAGCCCACCGGGTGGGACGG
ATATGTCCCCGGTCGGTAGCGCTCAAGCTGGCGCGCTACCCGAACGATCTGCGTTTCGAG
CGAGAGGCAGAGCTGCTGGAGCGGGTTCGGCATGCCAACGTGCCGCGACTGCTGGGACAT
GGAACGTGGAGGGCAGGCCCCCAGGGAGAAGCGCACCCCTATGTGGTGATGCAGTGGGTG
GAAGGGGTGAGGCTTTACCAATGGAATAAGGAGCGACTGCGGACCGCCCGGGAGGTGCTG
AGGGTGCTGGCGCAAGTGGCCAGGGCGCTGGAAGCCACGCATATGCGAGGGGGGCTGCAT
CGGGACGTGAAGGGAGAGAATGTGTTGGTGAGCCCAGAGGGCCATGCGTCCCTGATGGAC
TTCGGGTGTGGAACGTGGGAAGGGGCCGCGCCGCTCACAGGGGGGATACTGGCTCCAGGG
ACCAAGGCCTACCGAAGCCCCGAGGCATTGAGGTTTCACTGGAACCATCGGAACGAGGCC
GACGCCCACTACCAAGCGACCCCAGCGGATGACGTGTATGCACTGGGGGTAACGGCATAC
CGGCTGTGCACGGGAATTTATCCGCCCCCGGCGACGGAGCCCTCGGGAGTAGGAGAAGAT
GAACGGGAAACCCAGGAGGTGAAGAAGCCTCCGAGCCAGGTGAGGCCGCTGGTGCCCGCG
TTGGAGCAGCTCATCCTGAGAATGCTCAGGGACAACCCCAAGGAGAGAGGAAGAGCGGGA
GAATTGGCCGCCGAGATGGAGGCGTTGGCGGAGAGGGCCGGGGCGGAGGCCGATGAGCCG
ATGAACCCGAACCATTCGAGCGTGCCCTCAGAAATCACGGGTCGCCCGGTCTCGGTGCAG
AGAGAGTGGGGAGGGTGGCCCGTAGCGCTCGTGCTTGTAGCGGTGGGGCTGCTTCTGTGG
GGCTCAGGGAGCTTGAACACGGGGCGGCGGGTAGCGCCCGCCTCCCGTATGACGGAGGGG
GGAACCGGAGGGGTGGCGGACGCAGCCGTGGAGGCGTTGCCGGTGTCCAGCGCGGCGCGA
GAGCCCGAACCCAGTGGGCTGAACCTCGACATGCTCAAGGAGCCGTTACCGGGTCAACGC
CGTCCGCCGTGTCCTCGCTTCCAGATCAGCATCCAAGGAGGCTGTTGGCTCGAGGTTCCT
CAATCCTCTCCACCCTGCGGAGAGAGCTATTACGAATGGAAGGGTGCCTGCTACTCCCCA
GTGGCTGCACCTCCAAGGCCGCGCACATCGGATCCCCAGTAG

close this sectionFeature

BLASTP
Database:UniProtKB:2011_09
show BLAST table
InterPro
Database:interpro:38.0
IPR000719 Protein kinase, catalytic domain (Domain)
 [18-289]  PS50011
PS50011   PROTEIN_KINASE_DOM
 [19-282]  9.69999999999989e-35 PF00069
PF00069   Pkinase
IPR011009 Protein kinase-like domain (Domain)
 [4-284]  9.80000272130214e-47 SSF56112
SSF56112   Kinase_like
SignalP No significant hit
TMHMM No significant hit